DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sns and PXDNL

DIOPT Version :9

Sequence 1:NP_001036532.1 Gene:sns / 44097 FlyBaseID:FBgn0024189 Length:1542 Species:Drosophila melanogaster
Sequence 2:NP_653252.4 Gene:PXDNL / 137902 HGNCID:26359 Length:1463 Species:Homo sapiens


Alignment Length:761 Identity:158/761 - (20%)
Similarity:263/761 - (34%) Gaps:247/761 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   257 TCQARHKALS--PDMPMRATVQLSVLYP-----PGPPYIEGYSAGETLRRGQTVELMCRSRGGNP 314
            |.:..|..|.  |.:|.:.|| |.:.:.     ||       ||.:.|:...|:.|         
Human    34 TVRCMHLMLDHIPQVPQQTTV-LDLRFNRIREIPG-------SAFKKLKNLNTLLL--------- 81

  Fly   315 PAQLIWYKNGSQIRMAYRTSGRLSEN---IYTFTAEAGDNKARFRCEASNVMSQNPLKAEVELSV 376
                    |.:.||...|.:....||   :|.:..|.            :.:.:...|..:.|..
Human    82 --------NNNHIRKISRNAFEGLENLLYLYLYKNEI------------HALDKQTFKGLISLEH 126

  Fly   377 LFAPTHVTVMGPTEARVGDIVPLTCTTAPSNPPAEIKWMVGGRQVRNATSKTIVSPEGGWTTTSN 441
            |:...:...|...|. .||::.|......:|..::|                   |.|.:   ||
Human   127 LYIHFNQLEMLQPET-FGDLLRLERLFLHNNKLSKI-------------------PAGSF---SN 168

  Fly   442 ITAVVEPNKRSLVVIC----------------HGLNM---------QLTENVVSTHTINVLYPPA 481
            :.::......|..::|                ||...         :|....|::.|:.. :...
Human   169 LDSLKRLRLDSNALVCDCDLMWLGELLQGFAQHGHTQAAATCEYPRRLHGRAVASVTVEE-FNCQ 232

  Fly   482 PPLISGYMEGQIIPAGSVQKLLCVSSGGNPLATLTWYKN--------DKRIN------SVIRAAD 532
            .|.|:...:...:|:|:.....| .:.|||...:.|..|        |.|:|      .:||...
Human   233 SPRITFEPQDVEVPSGNTVYFTC-RAEGNPKPEIIWIHNNHSLDLEDDTRLNVFDDGTLMIRNTR 296

  Fly   533 KSVSAEITILANVSDNQAQYRCEASNSATEIPLFQSTTLSVHFAPETVKIRIEPE--ELRPGMEA 595
            :|             :|..|:|.|.|||.|... ||..|.....|......|:|:  |:..|...
Human   297 ES-------------DQGVYQCMARNSAGEAKT-QSAMLRYSSLPAKPSFVIQPQDTEVLIGTST 347

  Fly   596 TIICDSSSSNPPAKLSWWKD-GIPIEGINNTSKPGLWGGTVSTLEFRVNVTQEMNGQVYTCQSAN 659
            |:.| .::.:|...::|.:| |:.::|..:.:       |.|.| :..|:||..:|: :||.:.|
Human   348 TLEC-MATGHPHPLITWTRDNGLELDGSRHVA-------TSSGL-YLQNITQRDHGR-FTCHANN 402

  Fly   660 EALQRSAHEAVSLDVLYRPKFVPPPSSTAVGVEGESLQVSLQTRANPTPVTYKWTKDGTTIPQDG 724
            .  ..:...|.::.|...|:|...|....| :|..:::...:...||.||.. |||.|..:|.:|
Human   403 S--HGTVQAAANIIVQAPPQFTVTPKDQVV-LEEHAVEWLCEADGNPPPVIV-WTKTGGQLPVEG 463

  Fly   725 DHRIFADGGSLNFTRLHRDDAGIYSCSASNSQGGATLNITVVVEYGTTIKSVSENIVVNPGEDAM 789
            .|.:.: .|:|...|..:.|.|.|.|.|.:|.|               :|.||..:.|.|...|:
Human   464 QHTVLS-SGTLRIDRAAQHDQGQYECQAVSSLG---------------VKKVSVQLTVKPKALAV 512

  Fly   790 LSCTVEGKPLTEEHVKWERVGYDMTVKTSTTFANGTSYLHIKDAKREDVGNFRCVADNRVDNPTN 854
            .:                ::..|.:|:                                      
Human   513 FT----------------QLPQDTSVE-------------------------------------- 523

  Fly   855 RDILLIVKFAPEIAKTPTLLRAASGTGERGRLPCRAQGSPKPQFIWRQDKKDLPINRTYKYEVEE 919
                                     .|:...:.|.|||.|:|...|  :|:.:.|..:.|:.|::
Human   524 -------------------------VGKNINISCHAQGEPQPIITW--NKEGVQITESGKFHVDD 561

  Fly   920 RKIDSLTYESTLIVDKVAPADYGAYECVARNELGEAVETVRLEITS 965
                    |.||.:......|.|.|||||||..|.||..:.|.:|:
Human   562 --------EGTLTIYDAGFPDQGRYECVARNSFGLAVTNMFLTVTA 599

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snsNP_001036532.1 I-set 73..170 CDD:254352
Ig 76..155 CDD:299845
IG_like 186..279 CDD:214653 8/23 (35%)
Ig 197..279 CDD:299845 8/23 (35%)
IG_like 296..376 CDD:214653 13/82 (16%)
Ig 300..361 CDD:299845 10/63 (16%)
Ig 380..454 CDD:299845 12/73 (16%)
IG_like 490..573 CDD:214653 25/96 (26%)
Ig 501..560 CDD:299845 17/72 (24%)
Ig 584..666 CDD:299845 21/84 (25%)
IG_like 585..666 CDD:214653 20/83 (24%)
I-set 678..767 CDD:254352 26/88 (30%)
IGc2 692..757 CDD:197706 21/64 (33%)
Ig 788..849 CDD:143165 3/60 (5%)
Ig 885..960 CDD:143165 26/74 (35%)
FN3 967..1051 CDD:238020
PXDNLNP_653252.4 LRR 1 51..72 7/28 (25%)
leucine-rich repeat 52..85 CDD:275378 11/57 (19%)
LRR_8 53..134 CDD:316378 21/117 (18%)
LRR 2 75..96 6/37 (16%)
leucine-rich repeat 86..123 CDD:275378 8/48 (17%)
LRR 3 99..120 3/32 (9%)
LRR_8 123..182 CDD:316378 14/81 (17%)
LRR 4 123..144 4/21 (19%)
leucine-rich repeat 124..147 CDD:275378 6/23 (26%)
LRR 5 147..168 5/42 (12%)
leucine-rich repeat 148..171 CDD:275378 7/44 (16%)
leucine-rich repeat 172..184 CDD:275378 1/11 (9%)
LRRCT 180..232 CDD:214507 6/52 (12%)
Ig_3 234..309 CDD:316449 20/88 (23%)
Ig_3 329..402 CDD:316449 20/82 (24%)
Ig 432..505 CDD:325142 25/89 (28%)
Ig 528..596 CDD:325142 26/77 (34%)
peroxidasin_like 851..1286 CDD:188658
VWC 1400..1450 CDD:214564
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.