DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sns and AgaP_AGAP001766

DIOPT Version :9

Sequence 1:NP_001036532.1 Gene:sns / 44097 FlyBaseID:FBgn0024189 Length:1542 Species:Drosophila melanogaster
Sequence 2:XP_321317.5 Gene:AgaP_AGAP001766 / 1281409 VectorBaseID:AGAP001766 Length:297 Species:Anopheles gambiae


Alignment Length:237 Identity:52/237 - (21%)
Similarity:85/237 - (35%) Gaps:56/237 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   320 WYKNGSQIRMAYRTSGRLSENIYTFTAEA-------GD------------NKARFRCEAS-NVMS 364
            |||:..:.   ||.....|:.|.::..|.       .|            :...:|||.| ...|
Mosquito    69 WYKDNEEF---YRYVPSASQPIKSYKIEGIRVDPNHSDGTKVLLRGLTLKSSGIYRCEISAEAPS 130

  Fly   365 QNPLKAEVELSVLFAP---THVTVMGPTEARVGDIVPLTCTTAPSNPPAEIKWMVGGRQVRNATS 426
            .:.::.|..:.|:|.|   .|::..|....:.|:.:.|.||:..|.|...::|.:....|     
Mosquito   131 FDSVQGEGRMDVIFVPKDGPHISDGGRQSFQNGETMELNCTSGRSYPATTLQWYLNDLLV----- 190

  Fly   427 KTIVSPEGGWTTTSNITAVVE-PNKRSLVVICHGLNMQLTEN--VVSTHTINVLYPPAPPLISGY 488
                      |..:||....| .|:..|:....||:|.:...  :..|..|..:...:|.|..|.
Mosquito   191 ----------TDPNNIIQYPEVQNQHGLITTFLGLSMVVNHRHYIDGTIRIKCVANLSPVLWRGG 245

  Fly   489 MEGQI----IPAGSVQKLLCVSSGGN--------PLATLTWY 518
            .|..:    .|..:...:|.|.|.||        |..:|..|
Mosquito   246 QESIVQWEQPPIDNRVAMLLVKSNGNTRNRIFIVPFLSLVIY 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snsNP_001036532.1 I-set 73..170 CDD:254352
Ig 76..155 CDD:299845
IG_like 186..279 CDD:214653
Ig 197..279 CDD:299845
IG_like 296..376 CDD:214653 15/75 (20%)
Ig 300..361 CDD:299845 13/60 (22%)
Ig 380..454 CDD:299845 16/77 (21%)
IG_like 490..573 CDD:214653 10/41 (24%)
Ig 501..560 CDD:299845 8/26 (31%)
Ig 584..666 CDD:299845
IG_like 585..666 CDD:214653
I-set 678..767 CDD:254352
IGc2 692..757 CDD:197706
Ig 788..849 CDD:143165
Ig 885..960 CDD:143165
FN3 967..1051 CDD:238020
AgaP_AGAP001766XP_321317.5 Ig <60..125 CDD:299845 12/58 (21%)
Ig 150..>211 CDD:299845 16/75 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.