DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sns and AgaP_AGAP009253

DIOPT Version :9

Sequence 1:NP_001036532.1 Gene:sns / 44097 FlyBaseID:FBgn0024189 Length:1542 Species:Drosophila melanogaster
Sequence 2:XP_320040.3 Gene:AgaP_AGAP009253 / 1280215 VectorBaseID:AGAP009253 Length:258 Species:Anopheles gambiae


Alignment Length:254 Identity:58/254 - (22%)
Similarity:94/254 - (37%) Gaps:55/254 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 IVLASAPVPSHAQQQKFRTTPHD------------LQVLEGAEAMMRCEVANVAG-AVQWTKDG- 108
            :.:|..|.|..:.|...|.||.|            :..|.|..|.:.|.|.|:.. .|.|.:.. 
Mosquito    27 VPMALRPSPPSSSQSNLRRTPLDRGPHFDLSASKNITALVGKTAYLNCRVKNIGNKTVSWVRHRD 91

  Fly   109 ---FALGFSAVIPGFPRYSVLGDRK-QGIYN-------LRISNASINDDADYQCQVGPARLNSAI 162
               ..:|         |::...|:: |.::|       |:|......|...|:||:.   ....:
Mosquito    92 IHLLTVG---------RFTYTSDQRFQAVHNPQTDDWSLQIRYPQKRDTGVYECQIS---TTPPV 144

  Fly   163 RANAKLTVISPPASIEIKGYSHNSKVEVRENQDLQLKCIVANA-KPAAQIVWYRGN-VEYKPEKR 225
            ..:..|.|:.|..:  |.|.   ..:.:.....:.|.|||.|: :|.:.|.|...| |..:.|..
Mosquito   145 GHSMFLAVVEPITT--IVGV---PDLYINTGSTVNLTCIVRNSPEPPSTIFWTHNNQVSGEGEIN 204

  Fly   226 EDT----VEESTAKRFTTTSSLKLKPGPDDDYTEYTCQARHKALSPDMPMRATVQLSVL 280
            .|:    |...|.|...|||.|.::.....|..:|.|       ||.....:|:.:.:|
Mosquito   205 YDSPRGGVSVITEKGELTTSYLLIQRARTTDSGKYVC-------SPSNADPSTINVHIL 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snsNP_001036532.1 I-set 73..170 CDD:254352 24/121 (20%)
Ig 76..155 CDD:299845 22/103 (21%)
IG_like 186..279 CDD:214653 25/98 (26%)
Ig 197..279 CDD:299845 25/87 (29%)
IG_like 296..376 CDD:214653
Ig 300..361 CDD:299845
Ig 380..454 CDD:299845
IG_like 490..573 CDD:214653
Ig 501..560 CDD:299845
Ig 584..666 CDD:299845
IG_like 585..666 CDD:214653
I-set 678..767 CDD:254352
IGc2 692..757 CDD:197706
Ig 788..849 CDD:143165
Ig 885..960 CDD:143165
FN3 967..1051 CDD:238020
AgaP_AGAP009253XP_320040.3 IG_like 59..147 CDD:214653 19/99 (19%)
Ig 62..143 CDD:299845 19/92 (21%)
IG_like 163..255 CDD:214653 25/98 (26%)
IGc2 170..246 CDD:197706 24/82 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.