DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sns and AgaP_AGAP000863

DIOPT Version :9

Sequence 1:NP_001036532.1 Gene:sns / 44097 FlyBaseID:FBgn0024189 Length:1542 Species:Drosophila melanogaster
Sequence 2:XP_555858.3 Gene:AgaP_AGAP000863 / 1277377 VectorBaseID:AGAP000863 Length:330 Species:Anopheles gambiae


Alignment Length:309 Identity:75/309 - (24%)
Similarity:129/309 - (41%) Gaps:34/309 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   676 YRPKFVPPPSSTAVGVEGESLQVSLQTRANPTPVTYKWTK-DGTTIPQDGDHRIFADGGSLNFTR 739
            :.|.||.|..:..|....::....:........|.  |.| |...|....:| :..:.|.|:.| 
Mosquito    19 FEPDFVYPLENVTVAKGRDATFTCVVNNLGGYRVA--WIKADAKAILAIHEH-VITNNGRLSVT- 79

  Fly   740 LHRD--------------DAGIYSCSA-SNSQGGATLNITVVVEYGTTIKSVSENIVVNPGEDAM 789
             |.|              |.|:|.|.. ::.....|..:.||:......:..|.:::|..|..|.
Mosquito    80 -HNDYNTWTLVIRNVKMEDRGVYMCQVNTDPMKMQTAFLEVVIPPDIIYEETSGDMMVPEGGSAK 143

  Fly   790 LSCTVEGKPLTEEHVKWERV-GYDMTVKTST------TFANGTSYLHIKDAKREDVGNFRCVADN 847
            |.|...|.|  :..:.|.|. |.::..:..|      |...| ..|.:....|.::|.:.|:|.|
Mosquito   144 LICKARGYP--KPKIVWRREDGREIIARNGTHGKMKATIVEG-EMLSLTKVTRSEMGAYMCIASN 205

  Fly   848 RVDNPTNRDILLIVKFAPEIAKTPTLLRAASGTGERGRLPCRAQGSPKPQFIWRQDKKDLPINRT 912
            .|....::.:.|.|.|.|.|.....|:.|..||..  .|.|..:.|||....|:::..::.|:..
Mosquito   206 GVPPSVSKRLKLQVHFHPLIQVPNQLVGAPLGTDV--TLICNVEASPKAINYWQRENGEMIISNE 268

  Fly   913 YKYEVEERKIDSLTYESTLIVDKVAPADYGAYECVARNELGEAVETVRL 961
             :|.:.|.:......:.||::.|:..:|.|.|:|:::|.:|:|..|:||
Mosquito   269 -RYLMNENESSMYAVQMTLVIRKLHKSDMGGYKCISKNSIGDAEGTIRL 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snsNP_001036532.1 I-set 73..170 CDD:254352
Ig 76..155 CDD:299845
IG_like 186..279 CDD:214653
Ig 197..279 CDD:299845
IG_like 296..376 CDD:214653
Ig 300..361 CDD:299845
Ig 380..454 CDD:299845
IG_like 490..573 CDD:214653
Ig 501..560 CDD:299845
Ig 584..666 CDD:299845
IG_like 585..666 CDD:214653
I-set 678..767 CDD:254352 22/104 (21%)
IGc2 692..757 CDD:197706 15/80 (19%)
Ig 788..849 CDD:143165 17/67 (25%)
Ig 885..960 CDD:143165 20/74 (27%)
FN3 967..1051 CDD:238020
AgaP_AGAP000863XP_555858.3 IG_like 28..119 CDD:214653 17/95 (18%)
V-set 30..110 CDD:284989 16/84 (19%)
IG_like 131..219 CDD:214653 22/90 (24%)
Ig 133..219 CDD:299845 21/88 (24%)
Ig 223..316 CDD:299845 26/95 (27%)
IG_like 234..317 CDD:214653 25/86 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.