DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sns and AgaP_AGAP005849

DIOPT Version :9

Sequence 1:NP_001036532.1 Gene:sns / 44097 FlyBaseID:FBgn0024189 Length:1542 Species:Drosophila melanogaster
Sequence 2:XP_315876.4 Gene:AgaP_AGAP005849 / 1276518 VectorBaseID:AGAP005849 Length:828 Species:Anopheles gambiae


Alignment Length:182 Identity:50/182 - (27%)
Similarity:76/182 - (41%) Gaps:20/182 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   780 IVVNPGEDAMLSCTVEGKPLTEEHVKWERVGYDMTVKTSTTFANG----TSY----LHIKDAKRE 836
            |:|:.|....|.|...|.|  ..||:|.|.       ...|.:||    ||.    |:|....|.
Mosquito   279 IIVHEGTHLRLRCAATGTP--RPHVEWRRA-------DGKTISNGAWEATSMAGHTLNITKINRV 334

  Fly   837 DVGNFRCVADNRVDNPTNRDILLIVKFAPEIAKTPTLLRAASGTGERGRLPCRAQGSPKPQFIWR 901
            .:|.:.|:|||.:..|.|:...:.|.|.|.|.....:..|.:|:  .....|..:..|:....|.
Mosquito   335 HMGAYHCLADNGISPPANQTFNIEVHFPPLIRVRNQMAYAVNGS--TVTFVCEIEAFPEALKYWE 397

  Fly   902 QDKKDLPINRTYKYEVEERKIDSLTYESTLIVDKVAPADYGAYECVARNELG 953
            :......:....|:::|.. .|.......|.:..:.|:|:|.|.|||:||||
Mosquito   398 RFPGGRLLEPGDKFQMETH-YDGYKSVMRLNITNIRPSDFGEYHCVAKNELG 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snsNP_001036532.1 I-set 73..170 CDD:254352
Ig 76..155 CDD:299845
IG_like 186..279 CDD:214653
Ig 197..279 CDD:299845
IG_like 296..376 CDD:214653
Ig 300..361 CDD:299845
Ig 380..454 CDD:299845
IG_like 490..573 CDD:214653
Ig 501..560 CDD:299845
Ig 584..666 CDD:299845
IG_like 585..666 CDD:214653
I-set 678..767 CDD:254352
IGc2 692..757 CDD:197706
Ig 788..849 CDD:143165 21/68 (31%)
Ig 885..960 CDD:143165 18/69 (26%)
FN3 967..1051 CDD:238020
AgaP_AGAP005849XP_315876.4 Collagen 140..200 CDD:189968
IG_like 277..359 CDD:214653 26/88 (30%)
IGc2 283..348 CDD:197706 22/73 (30%)
Ig 362..456 CDD:299845 22/90 (24%)
IG_like 373..456 CDD:214653 20/79 (25%)
OLF 542..787 CDD:280371
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.