DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment sns and AgaP_AGAP013433

DIOPT Version :9

Sequence 1:	NP_001036532.1	Gene:	sns / 44097	FlyBaseID:	FBgn0024189	Length:	1542	Species:	Drosophila melanogaster
Sequence 2:	XP_003437142.1	Gene:	AgaP_AGAP013433 / 11176086	VectorBaseID:	AGAP013433	Length:	118	Species:	Anopheles gambiae

Alignment Length:	80	Identity:	20/80 - (25%)
Similarity:	30/80 - (37%)	Gaps:	22/80 - (27%)

- Green bases have known domain annotations that are detailed below.

  Fly   508 GGNPLATLTWYKNDKRINSVIRAADKSVS----AEITILANVSD---NQ---------------A 550
            |.:.|.::.|||:::..........||:.    ..:|:|.|.:.   ||               .
Mosquito    27 GTHKLNSVKWYKDEREFFRYSPLMPKSLMLFDVEGVTVLQNSTGQICNQFMCSIQLHRLNIRSSG 91

  Fly   551 QYRCEASNSATEIPL 565
            .||||.|..|.|..|
Mosquito    92 SYRCEISGDAPEFKL 106

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
sns	NP_001036532.1	I-set	73..170	CDD:254352
		Ig	76..155	CDD:299845
		IG_like	186..279	CDD:214653
		Ig	197..279	CDD:299845
		IG_like	296..376	CDD:214653
		Ig	300..361	CDD:299845
		Ig	380..454	CDD:299845
		IG_like	490..573	CDD:214653	20/80 (25%)
		Ig	501..560	CDD:299845	17/73 (23%)
		Ig	584..666	CDD:299845
		IG_like	585..666	CDD:214653
		I-set	678..767	CDD:254352
		IGc2	692..757	CDD:197706
		Ig	788..849	CDD:143165
		Ig	885..960	CDD:143165
		FN3	967..1051	CDD:238020
AgaP_AGAP013433	XP_003437142.1	Ig	7..100	CDD:299845	17/72 (24%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910