DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sns and Il1rl2

DIOPT Version :9

Sequence 1:NP_001036532.1 Gene:sns / 44097 FlyBaseID:FBgn0024189 Length:1542 Species:Drosophila melanogaster
Sequence 2:NP_001343407.1 Gene:Il1rl2 / 107527 MGIID:1913107 Length:574 Species:Mus musculus


Alignment Length:684 Identity:126/684 - (18%)
Similarity:202/684 - (29%) Gaps:294/684 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   709 VTYKWTKDGTTIPQDGDH--RIFADGGSLNFTRLHRDDAGIYSCSASNSQG--GATLNITVVVEY 769
            |...|.|..:..|...:.  |:..|...:.|..|..:|:|||.|...|:..  ...:|:||:..:
Mouse    54 VNLTWYKTPSKSPVSNNRHLRVHQDQTWILFLPLTLEDSGIYQCVIRNAHNCYQIAVNLTVLKNH 118

  Fly   770 -------GTTIKSVSENIVVNP-GEDAMLSCTV---EGKPLTEEHVKWERVGYDMTVKTSTTFAN 823
                   |:.:.|......:.| |:...|:|.:   |...|  :.:||.: |.: .:|....::.
Mouse   119 WCDSSMEGSPVNSPDVYQQILPIGKSGSLNCHLYFPESCAL--DSIKWYK-GCE-EIKAGKKYSP 179

  Fly   824 GTSYLHIKDAKREDVGNFRCVA------------------------DNRVDN---PTNRDILLIV 861
            ..:.|.:.:...||.|::.|.|                        ..|:.|   |.|..|    
Mouse   180 SGAKLLVNNVAVEDGGSYACSARLTHLGRHFTIRNYIAVNTKEVEYGRRIPNITYPKNNSI---- 240

  Fly   862 KFAPEIAKTPTLLRAA--SGTGERGRLPCRAQGSPKPQFIWRQDKKDLPINRTY--KYEVEERKI 922
                |:....||:...  :.|.|...|.|           ||       :|.|.  .|..:.::|
Mouse   241 ----EVPLGSTLIVNCNITDTKENTNLRC-----------WR-------VNNTLVDDYYKDSKRI 283

  Fly   923 -----------DSLTYESTLIVDKVAPADYG-AYECVARNELGEAVETVRLEITSQPDPPLSLNI 975
                       |.:.|...:...||...||| .:.|.|                           
Mouse   284 QEGIETNVSLRDQIRYTVNITFLKVKMEDYGRPFTCHA--------------------------- 321

  Fly   976 LNVTHDTVTLAWTPGFDGGLKASYRVRYRMADREQYKYIDGLPNSHKLTIGGLR------MNTLY 1034
                              |:.|:|.:           .|..:|:.....:|||.      ::.|:
Mouse   322 ------------------GVSAAYII-----------LIYPVPDFRAYLLGGLMAFLLLVVSVLF 357

  Fly  1035 LFS-----VMSWNELGQSSYLPDLARAETKEAPP-----------PSHPASSLGGGPPTTSQTPL 1083
            :::     :|.|.   :|::       .|.:||.           |.:|..|.|....|      
Mouse   358 IYNSFKIDIMLWY---RSAF-------HTAQAPDDEKLYDAYVLYPKYPRGSQGHDVDT------ 406

  Fly  1084 GGTSGMLLVGVGAGIVVVLL----------NVFVIGCCLHKRNE-----------KRLKRGLELM 1127
                          :|:.:|          .:|:.|     |:|           :.:|....||
Mouse   407 --------------LVLKILPEVLEKQCGYKLFIFG-----RDEFPGQAVASVIDENIKLCRRLM 452

  Fly  1128 PAELTEDSSNTPNLVIIGISLAAFGFL--LVNASLVAWFFVHQRRKKVAETTNQPAKTATIEMYA 1190
            .....|.||              ||||  |....:..:..:.|...||          ..||:  
Mouse   453 VFVAPESSS--------------FGFLKNLSEEQIAVYNALIQHGMKV----------ILIEL-- 491

  Fly  1191 PSSYNDTVTGETLSSVSEKSESYSNEGSSQPEYIDEVRKKAASTY----LVEGSD---------- 1241
                             ||.:.|    |:.||.|..:|:|..:..    ..|.|.          
Mouse   492 -----------------EKVKDY----STMPESIQYIRQKHGAIQWDGDFTEQSQCAKTKFWKKV 535

  Fly  1242 ---MPPPRY------QKDGTLPVIYPNNVVNACT 1266
               |||.||      |..|.:|........||.|
Mouse   536 RYHMPPRRYPASSPVQLLGHIPCNCKAGKCNAAT 569

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snsNP_001036532.1 I-set 73..170 CDD:254352
Ig 76..155 CDD:299845
IG_like 186..279 CDD:214653
Ig 197..279 CDD:299845
IG_like 296..376 CDD:214653
Ig 300..361 CDD:299845
Ig 380..454 CDD:299845
IG_like 490..573 CDD:214653
Ig 501..560 CDD:299845
Ig 584..666 CDD:299845
IG_like 585..666 CDD:214653
I-set 678..767 CDD:254352 17/61 (28%)
IGc2 692..757 CDD:197706 14/49 (29%)
Ig 788..849 CDD:143165 14/87 (16%)
Ig 885..960 CDD:143165 17/88 (19%)
FN3 967..1051 CDD:238020 12/94 (13%)
Il1rl2NP_001343407.1 Ig 25..115 CDD:416386 16/60 (27%)
Ig strand A' 31..35 CDD:409353
Ig strand B 39..44 CDD:409353
Ig strand C 55..59 CDD:409353 0/3 (0%)
Ig strand C' 64..66 CDD:409353 0/1 (0%)
Ig strand D 74..78 CDD:409353 1/3 (33%)
Ig strand E 80..84 CDD:409353 0/3 (0%)
Ig strand F 93..101 CDD:409353 4/7 (57%)
Ig strand G 104..115 CDD:409353 2/10 (20%)
Ig 135..222 CDD:416386 16/90 (18%)
Ig strand A 135..140 CDD:409353 0/4 (0%)
Ig strand B 145..149 CDD:409353 1/3 (33%)
Ig strand C 161..166 CDD:409353 2/4 (50%)
Ig strand C' 169..171 CDD:409353 0/2 (0%)
Ig strand D 176..180 CDD:409353 0/3 (0%)
Ig strand E 182..187 CDD:409353 1/4 (25%)
Ig strand F 196..205 CDD:409353 2/8 (25%)
Ig strand G 208..221 CDD:409353 0/12 (0%)
Ig 230..332 CDD:416386 29/183 (16%)
Ig strand A 230..233 CDD:409353 1/2 (50%)
Ig strand A' 238..241 CDD:409353 1/10 (10%)
Ig strand B 246..255 CDD:409353 2/8 (25%)
Ig strand C 262..268 CDD:409353 4/23 (17%)
Ig strand C' 270..273 CDD:409353 1/2 (50%)
Ig strand G 322..332 CDD:409353 3/20 (15%)
TIR 389..539 CDD:396246 38/221 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.