| Sequence 1: | NP_001036532.1 | Gene: | sns / 44097 | FlyBaseID: | FBgn0024189 | Length: | 1542 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_031747070.1 | Gene: | LOC101735075 / 101735075 | -ID: | - | Length: | 312 | Species: | Xenopus tropicalis |
| Alignment Length: | 288 | Identity: | 64/288 - (22%) |
|---|---|---|---|
| Similarity: | 102/288 - (35%) | Gaps: | 81/288 - (28%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 91 MRCEVANVAGAVQ---WTKDGFALGFSAVIPGFPRYSVLGDRKQGIYNLRISNASINDDADYQCQ 152
Fly 153 VG------PARLNSAIRANAKLTVISPPASIEIKGYSHNSKVEVRENQDLQLKCIVANAKPAAQI 211
Fly 212 VWYRGNVEYKPEKREDTVEESTAKRFTTTSSLKLKPGPDDDYTEYTC---QARHK-ALSPDMPMR 272
Fly 273 ATVQLSVLYPPGPPYIEGYSAGETLRRGQTVELMCR-----SRGGNPPAQLIWYKNGSQIRMAYR 332
Fly 333 TSGRLSENIYTFTAEAGDNKARFRCEAS 360 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| sns | NP_001036532.1 | I-set | 73..170 | CDD:254352 | 22/87 (25%) |
| Ig | 76..155 | CDD:299845 | 17/72 (24%) | ||
| IG_like | 186..279 | CDD:214653 | 21/96 (22%) | ||
| Ig | 197..279 | CDD:299845 | 18/85 (21%) | ||
| IG_like | 296..376 | CDD:214653 | 14/70 (20%) | ||
| Ig | 300..361 | CDD:299845 | 14/66 (21%) | ||
| Ig | 380..454 | CDD:299845 | |||
| IG_like | 490..573 | CDD:214653 | |||
| Ig | 501..560 | CDD:299845 | |||
| Ig | 584..666 | CDD:299845 | |||
| IG_like | 585..666 | CDD:214653 | |||
| I-set | 678..767 | CDD:254352 | |||
| IGc2 | 692..757 | CDD:197706 | |||
| Ig | 788..849 | CDD:143165 | |||
| Ig | 885..960 | CDD:143165 | |||
| FN3 | 967..1051 | CDD:238020 | |||
| LOC101735075 | XP_031747070.1 | Ig | 11..90 | CDD:416386 | 20/77 (26%) |
| Ig strand A | 12..15 | CDD:409353 | |||
| Ig strand A' | 20..23 | CDD:409353 | |||
| Ig strand B | 27..33 | CDD:409353 | 0/2 (0%) | ||
| Ig strand C | 44..49 | CDD:409353 | 1/4 (25%) | ||
| Ig strand C' | 51..53 | CDD:409353 | 0/1 (0%) | ||
| Ig strand E | 58..63 | CDD:409353 | 1/4 (25%) | ||
| Ig strand F | 71..76 | CDD:409353 | 2/4 (50%) | ||
| Ig strand G | 84..90 | CDD:409353 | 3/5 (60%) | ||
| Ig | 96..177 | CDD:416386 | 23/111 (21%) | ||
| Ig strand B | 108..115 | CDD:409353 | 3/6 (50%) | ||
| Ig strand C | 121..127 | CDD:409353 | 0/5 (0%) | ||
| Ig strand C' | 130..135 | CDD:409353 | 2/13 (15%) | ||
| Ig strand E | 139..142 | CDD:409353 | 0/2 (0%) | ||
| Ig strand F | 151..161 | CDD:409353 | 3/9 (33%) | ||
| Ig strand G | 167..177 | CDD:409353 | 1/9 (11%) | ||
| Ig | 187..>251 | CDD:416386 | 14/72 (19%) | ||
| Ig strand A' | 192..194 | CDD:409353 | 0/1 (0%) | ||
| Ig strand B | 198..205 | CDD:409353 | 2/6 (33%) | ||
| Ig strand C | 217..222 | CDD:409353 | 1/4 (25%) | ||
| Ig strand C' | 225..230 | CDD:409353 | 0/10 (0%) | ||
| Ig strand E | 234..238 | CDD:409353 | 1/3 (33%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||