DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sns and LOC100496188

DIOPT Version :9

Sequence 1:NP_001036532.1 Gene:sns / 44097 FlyBaseID:FBgn0024189 Length:1542 Species:Drosophila melanogaster
Sequence 2:XP_031748713.1 Gene:LOC100496188 / 100496188 -ID:- Length:852 Species:Xenopus tropicalis


Alignment Length:954 Identity:184/954 - (19%)
Similarity:302/954 - (31%) Gaps:334/954 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 TTPHDLQVLEGAEAMMRC--EVANVAG-----AVQWTKDGFALGFSAVI-------PGFPRYSVL 126
            |.|.|.....|.:|::.|  .|.|...     |:.|     ..|...|:       ...||.|: 
 Frog    30 TVPPDQSSPMGRDALLPCTFRVDNPPMNPKFLAILW-----HFGDKEVLRYDNKGKVSSPRVSI- 88

  Fly   127 GDRK---QGIYNLRISNASINDDADYQCQV--GPARLNSAIRANAKLTVISPPASIEIKGYSHNS 186
             |.:   :|..:|.:||.:::|...|:|.|  .|......||    |.:.:.|..:..|      
 Frog    89 -DERALLEGNASLSLSNVTVSDGGTYRCSVIYSPETQKKEIR----LRIHALPEVVVAK------ 142

  Fly   187 KVEVRENQDLQLKCIVANAKP-AAQIVWYRGNVEYKPEKREDTVEESTAKRFTTTSSLKLKPGPD 250
            :..|| ||...|:|.|.:..| ...:.|.| |.:..|......::::....|...|:|.|.|...
 Frog   143 RTLVR-NQGTALRCSVTDFYPQRITVTWLR-NGKVLPNSALGPLQQNADGTFRLNSTLTLTPSDT 205

  Fly   251 DDYTEYTCQARHKALSPDMPMRATVQLSVLYPPGPPYIEGYSAGETLRRGQTVELMCRSRGGNPP 315
            :|..|..|..:|::|.........||..|     ||.::.|||               ...|.|.
 Frog   206 EDTPEIACLVQHESLPTPRRDSFRVQYGV-----PPSVQVYSA---------------KINGRPE 250

  Fly   316 AQLIWYKNGSQIRMAYRTSGRLSENIYTFTAEAGDNKARFRCEASNVMSQNPLKAEVELSVLFAP 380
            ..|:                                     ||||.                |.|
 Frog   251 QVLV-------------------------------------CEASQ----------------FQP 262

  Fly   381 THVTVMGPTEARVGDIVPLTCTTAPSNPPAEIKWMVGG------RQVRNATSKT----IVSPEGG 435
                                       .|..|:|::.|      ::.|:...||    :::|.||
 Frog   263 ---------------------------EPVRIQWLLNGKIPEDLKKSRDGGFKTGSYYVINPTGG 300

  Fly   436 WTTTSNITAVVEPNKRSLVVICHGLNMQLTENVVSTHTINVLYPPAPPLISGYMEGQIIPAGSVQ 500
             ....||:..|| ::..|:.|...|.:...:....                 |..|.|..|..:.
 Frog   301 -IQVGNISCAVE-HETLLLPITETLQLSPEDTEAK-----------------YSAGNIAAAIFLT 346

  Fly   501 KLLCVSSGGNPLATLTWYKNDKRINSVIRAADKSVSAEITILANVSDNQAQYRCEASNSATEIPL 565
            .||.    |..:....|:...||                           :|             
 Frog   347 MLLM----GAGITAGLWFLIYKR---------------------------KY------------- 367

  Fly   566 FQSTTLSVHFAPETVKIRIEPEELRPGMEATIICDSSSSNPPAKLSW---WKDGIPIEGINNTSK 627
            ||...:|.....:||:          |.:.|:.|.:|......::.|   ..||...|...:.::
 Frog   368 FQRFRVSHIHRSQTVE----------GKKVTLYCVASDCPKGPRVIWSVQGHDGKKTEVAEDEAQ 422

  Fly   628 PGLWGGTVSTLEFRVNVTQE-MNGQVYTCQSANEALQRSAHEAVSLDVLYRPKFVPPPSSTAVGV 691
            ....|..:...||.|...:. .:|:.....|.:.....|||:    |::...|||         .
 Frog   423 AEGEGKMLLGQEFTVRTDRTGTDGRHNVTSSLSFTPDVSAHK----DMVVFCKFV---------C 474

  Fly   692 EGESLQVSLQTRANPTPVTYKWTKDGTTIPQDGDHRIFADGGSLNFTRLHRDD---AGI---YSC 750
            :|::.:..|..    :.::.|        |:|......:|.|.: .:||...:   .||   :||
 Frog   475 DGKAKEEQLHC----SFISAK--------PKDYIKLSLSDSGEV-LSRLTLQEFYPRGIQIRWSC 526

  Fly   751 SASNSQGGATLNITVVVEYGTTIKSVSENIVVNPGEDAMLSCTVEGKPLTEE----HVKWERVGY 811
            ...:.|...::|.........|..:.||             |.:.|:..|:.    .|.|.:   
 Frog   527 GVGHYQELESINERFTPNSNYTYNTESE-------------CKILGQLFTDPGFKVRVTWNQ--- 575

  Fly   812 DMTVKTSTTFANGTSYLHIKDAKREDVGNFRCVADNRVDNPTNRDILLIVKFAPEIAKTP---TL 873
                ::||  ..|:.....:|                                ||....|   .:
 Frog   576 ----QSST--GQGSREFSARD--------------------------------PEFPWCPWMEEI 602

  Fly   874 LRAASGTGERGRLPCRAQG-SPKP-QFIW-RQD---KKDLPINRTYKY---EVEERKIDSLTYES 929
            ::.|......||..|..:| .||. :..| |::   ::...::.:.||   |:|::|....|:..
 Frog   603 IKPALKHNSEGRFQCEIRGYFPKALEVKWLRREAGGQELFSVSPSEKYKIPEMEQKKEADGTFSC 667

  Fly   930 T--LIVDKVAPADYGA-YEC-VARNELGEAVE--TVRLEITSQP 967
            |  |||.....:|.|| :.| |....|||.::  |..|.:|..|
 Frog   668 TAALIVSVSGKSDNGAEFICRVGHPSLGEPLDRSTGALSVTGVP 711

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snsNP_001036532.1 I-set 73..170 CDD:254352 28/112 (25%)
Ig 76..155 CDD:299845 24/97 (25%)
IG_like 186..279 CDD:214653 24/93 (26%)
Ig 197..279 CDD:299845 20/82 (24%)
IG_like 296..376 CDD:214653 7/79 (9%)
Ig 300..361 CDD:299845 6/60 (10%)
Ig 380..454 CDD:299845 15/83 (18%)
IG_like 490..573 CDD:214653 12/82 (15%)
Ig 501..560 CDD:299845 7/58 (12%)
Ig 584..666 CDD:299845 14/85 (16%)
IG_like 585..666 CDD:214653 14/84 (17%)
I-set 678..767 CDD:254352 18/94 (19%)
IGc2 692..757 CDD:197706 13/70 (19%)
Ig 788..849 CDD:143165 9/64 (14%)
Ig 885..960 CDD:143165 26/89 (29%)
FN3 967..1051 CDD:238020 1/1 (100%)
LOC100496188XP_031748713.1 V-set 30..133 CDD:400157 28/113 (25%)
Ig strand B 41..48 CDD:409353 1/6 (17%)
CDR1 49..58 CDD:409353 2/8 (25%)
FR2 60..70 CDD:409353 3/14 (21%)
Ig strand C 60..67 CDD:409353 2/11 (18%)
Ig strand C' 76..79 CDD:409353 0/2 (0%)
FR3 82..117 CDD:409353 11/36 (31%)
Ig strand D 85..91 CDD:409353 3/7 (43%)
Ig strand E 97..103 CDD:409353 1/5 (20%)
Ig strand A 136..143 CDD:409353 2/12 (17%)
Ig strand B 150..160 CDD:409353 3/9 (33%)
C1-set 153..220 CDD:400140 17/67 (25%)
Ig strand C 165..171 CDD:409353 1/5 (20%)
Ig strand C' 173..176 CDD:409353 0/2 (0%)
Ig strand D 180..187 CDD:409353 0/6 (0%)
Ig strand E 190..200 CDD:409353 3/9 (33%)
Ig strand F 210..217 CDD:409353 2/6 (33%)
Ig 234..315 CDD:416386 29/182 (16%)
Ig strand A 235..242 CDD:409353 2/6 (33%)
Ig strand B 251..258 CDD:409353 3/43 (7%)
Ig strand C 264..270 CDD:409353 2/5 (40%)
Ig strand C' 273..275 CDD:409353 1/1 (100%)
Ig strand E 287..295 CDD:409353 2/7 (29%)
Ig strand F 302..312 CDD:409353 4/10 (40%)
IgC1 <617..702 CDD:409354 24/84 (29%)
Ig strand C 628..632 CDD:409354 0/3 (0%)
Ig strand E 669..673 CDD:409354 1/3 (33%)
Ig strand F 684..689 CDD:409354 1/4 (25%)
Ig strand G 699..702 CDD:409354 0/2 (0%)
Ig 701..804 CDD:416386 4/11 (36%)
Ig strand B 712..729 CDD:409353 184/954 (19%)
Ig strand C 734..741 CDD:409353
Ig strand C' 750..753 CDD:409353
Ig strand E 766..781 CDD:409353
Ig strand F 789..795 CDD:409353
Ig strand G 798..804 CDD:409353
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.