| Sequence 1: | NP_001036532.1 | Gene: | sns / 44097 | FlyBaseID: | FBgn0024189 | Length: | 1542 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_002938564.3 | Gene: | xilr2 / 100496017 | XenbaseID: | XB-GENE-6464634 | Length: | 372 | Species: | Xenopus tropicalis |
| Alignment Length: | 289 | Identity: | 63/289 - (21%) |
|---|---|---|---|
| Similarity: | 106/289 - (36%) | Gaps: | 73/289 - (25%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 706 PTPVTYKWTKDGTTIPQDGDHRIFADGGSLNF---TRLHRDDAGIYSCSASN-----SQGGATLN 762
Fly 763 -ITVVVEYGTTIK---------------------------SVSENIVVNPGEDAMLSCTVEGKPL 799
Fly 800 TEEHVKWERVGYDMTVKTSTTFANGTSYLHIKDAKREDVGNFRC----VADNRVDNPTNRDILLI 860
Fly 861 -VKFAPEIAKTPTLLRAASGTGERGRLPCRAQGSPKPQFIWRQDKKDLPINRTYKYEVEERKIDS 924
Fly 925 LTYESTLIVDKVAPADYGAYECVARNELG 953 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| sns | NP_001036532.1 | I-set | 73..170 | CDD:254352 | |
| Ig | 76..155 | CDD:299845 | |||
| IG_like | 186..279 | CDD:214653 | |||
| Ig | 197..279 | CDD:299845 | |||
| IG_like | 296..376 | CDD:214653 | |||
| Ig | 300..361 | CDD:299845 | |||
| Ig | 380..454 | CDD:299845 | |||
| IG_like | 490..573 | CDD:214653 | |||
| Ig | 501..560 | CDD:299845 | |||
| Ig | 584..666 | CDD:299845 | |||
| IG_like | 585..666 | CDD:214653 | |||
| I-set | 678..767 | CDD:254352 | 16/69 (23%) | ||
| IGc2 | 692..757 | CDD:197706 | 12/58 (21%) | ||
| Ig | 788..849 | CDD:143165 | 14/64 (22%) | ||
| Ig | 885..960 | CDD:143165 | 17/69 (25%) | ||
| FN3 | 967..1051 | CDD:238020 | |||
| xilr2 | XP_002938564.3 | Ig | 29..110 | CDD:416386 | 18/88 (20%) |
| Ig strand A | 30..34 | CDD:409353 | 1/3 (33%) | ||
| Ig strand A' | 41..44 | CDD:409353 | 1/6 (17%) | ||
| Ig strand B | 47..54 | CDD:409353 | 1/6 (17%) | ||
| Ig strand C | 64..69 | CDD:409353 | 1/4 (25%) | ||
| Ig strand E | 80..84 | CDD:409353 | 1/3 (33%) | ||
| Ig strand F | 92..99 | CDD:409353 | 3/6 (50%) | ||
| Ig | 122..206 | CDD:416386 | 21/89 (24%) | ||
| Ig strand A | 122..126 | CDD:409353 | 0/3 (0%) | ||
| Ig strand A' | 130..133 | CDD:409353 | 0/2 (0%) | ||
| Ig strand B | 136..143 | CDD:409353 | 0/6 (0%) | ||
| Ig strand C | 150..155 | CDD:409353 | 0/4 (0%) | ||
| Ig strand C' | 156..159 | CDD:409353 | 1/2 (50%) | ||
| Ig strand E | 170..175 | CDD:409353 | 3/5 (60%) | ||
| Ig strand F | 183..190 | CDD:409353 | 2/6 (33%) | ||
| Ig | 215..298 | CDD:416386 | 20/85 (24%) | ||
| Ig strand A | 216..220 | CDD:409353 | 0/3 (0%) | ||
| Ig strand A' | 222..225 | CDD:409353 | 1/2 (50%) | ||
| Ig strand B | 228..235 | CDD:409353 | 0/6 (0%) | ||
| Ig strand C | 244..249 | CDD:409353 | 2/10 (20%) | ||
| Ig strand C' | 257..260 | CDD:409353 | 0/2 (0%) | ||
| Ig strand E | 264..269 | CDD:409353 | 1/4 (25%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||