DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sns and LOC100494743

DIOPT Version :9

Sequence 1:NP_001036532.1 Gene:sns / 44097 FlyBaseID:FBgn0024189 Length:1542 Species:Drosophila melanogaster
Sequence 2:XP_031755242.1 Gene:LOC100494743 / 100494743 -ID:- Length:512 Species:Xenopus tropicalis


Alignment Length:547 Identity:113/547 - (20%)
Similarity:197/547 - (36%) Gaps:174/547 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   295 ETLRRGQTVELMCRSRGGNPPAQL----------IW---YKNGSQIRMAYRTSGRLSENI-YTFT 345
            :.|..|::..:.|...|..|...|          |:   :|:.|::       |.::|.: |..|
 Frog     3 DMLEEGKSYIITCTVHGVAPIQNLRVTILRGKEEIYNKTFKDDSRV-------GNITEPVTYQIT 60

  Fly   346 AEAGDNKARFRCEASNVMSQNPLKAEVELSVLFAPTHVTVMGPTEARVGDIVPLTCTTA-----P 405
            ||..||...|.|:|:..:.                   ||:|      ...||....|.     |
 Frog    61 AERSDNMEDFSCQATLALG-------------------TVIG------NKTVPSANVTVRTFALP 100

  Fly   406 SNPPAEI-KWMVGGRQVRNATSKTIVSPEGGWTTTSNITAVVEPNKRSLVVICHGLNMQLTENVV 469
            ..|..|: :|:..|.               |...|..::....|...:|.:|.:.:.:.:.:..:
 Frog   101 DKPKLEVNQWIEIGT---------------GQMATCKVSNAFPPEHLNLTMIFNTITLSMNKTKM 150

  Fly   470 STHTI--NVLYPPAPPLISGYMEGQIIPAGSVQKLLC----VSSGGNPLATLTWYK--------- 519
            :..::  :...|| ..|:..|            :|||    ||........:..|:         
 Frog   151 ADGSVLGSAGIPP-DTLLGTY------------RLLCKAELVSLSSEASTDIHIYELPDISFTVS 202

  Fly   520 NDKRI--------------NS-----VIRAADKSVSAEITILANVSDN----QAQYRCEA-SNSA 560
            ||..:              ||     .||...:.:..:..:..||..|    |:...||| ....
 Frog   203 NDSVLLGDSITASCLLNNNNSDPYGVTIRLNGEEICKDPAMDCNVPVNRRSPQSLVSCEAFIKDN 267

  Fly   561 TEIPLFQSTTLSVHFAPETVKIRIEPEE------LRPGMEATIICDSSSSNPPA----KLSWWKD 615
            |:|.:.:..:|:||::|:     .:.::      ||.|......|.:..:.||.    :.||   
 Frog   268 TDITVRREKSLTVHYSPQ-----FQDDQCPGHFALREGNNGPFKCQADGNPPPTVTCRRDSW--- 324

  Fly   616 GIPIEGINNTSKPGLWGGTVSTLEFRVNVTQEMNGQVYTCQSANEALQRSAHEAVSLDVLYRPKF 680
            .:|.:                 ..|.:|.|.  :|| |.||:.||...:|  ::|.::|.|.|  
 Frog   325 NLPTD-----------------RTFDINRTH--SGQ-YECQATNEHGVQS--KSVMVEVQYPP-- 365

  Fly   681 VPPPSSTAVGV----EGESLQVSLQTRANPTPVTYKWTKDGTTIPQDGDHRIFADGGSLNF-TRL 740
             ..|:.|||..    :|.:|.|:......|.| .|:|     .|| :|...::.:..|:.| ...
 Frog   366 -ATPNITAVPTATIPKGGALNVTCWADGLPQP-EYRW-----EIP-NGASVVYMNNNSVIFIPET 422

  Fly   741 HRDDAGIYSCSASNSQGGATLNITVVV 767
            ....:|.|:|.|.|..||:::.:.:.|
 Frog   423 STSHSGTYTCHAVNQHGGSSVALVITV 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snsNP_001036532.1 I-set 73..170 CDD:254352
Ig 76..155 CDD:299845
IG_like 186..279 CDD:214653
Ig 197..279 CDD:299845
IG_like 296..376 CDD:214653 20/93 (22%)
Ig 300..361 CDD:299845 19/74 (26%)
Ig 380..454 CDD:299845 14/79 (18%)
IG_like 490..573 CDD:214653 22/119 (18%)
Ig 501..560 CDD:299845 19/95 (20%)
Ig 584..666 CDD:299845 19/91 (21%)
IG_like 585..666 CDD:214653 19/90 (21%)
I-set 678..767 CDD:254352 24/93 (26%)
IGc2 692..757 CDD:197706 17/65 (26%)
Ig 788..849 CDD:143165
Ig 885..960 CDD:143165
FN3 967..1051 CDD:238020
LOC100494743XP_031755242.1 Ig 8..78 CDD:416386 19/76 (25%)
Ig strand B 10..19 CDD:409353 1/8 (13%)
Ig strand C 26..32 CDD:409353 1/5 (20%)
Ig strand C' 34..37 CDD:409353 0/2 (0%)
Ig strand E 52..60 CDD:409353 2/7 (29%)
Ig strand F 68..75 CDD:409353 2/6 (33%)
Ig 284..361 CDD:416386 22/106 (21%)
Ig strand B 303..307 CDD:409353 0/3 (0%)
Ig strand C 316..320 CDD:409353 0/3 (0%)
Ig strand E 331..334 CDD:409353 1/2 (50%)
Ig strand F 341..346 CDD:409353 3/5 (60%)
Ig strand G 355..358 CDD:409353 0/2 (0%)
Ig_3 368..436 CDD:404760 20/74 (27%)
Ig strand B 383..390 CDD:409353 2/6 (33%)
Ig strand C 396..402 CDD:409353 3/11 (27%)
Ig strand C' 405..414 CDD:409353 1/8 (13%)
Ig strand E 417..423 CDD:409353 1/5 (20%)
Ig strand F 426..437 CDD:409353 4/10 (40%)
Ig strand G 440..450 CDD:409353 2/10 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.