DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sns and btn2a1

DIOPT Version :9

Sequence 1:NP_001036532.1 Gene:sns / 44097 FlyBaseID:FBgn0024189 Length:1542 Species:Drosophila melanogaster
Sequence 2:XP_012808960.1 Gene:btn2a1 / 100170443 XenbaseID:XB-GENE-6459012 Length:347 Species:Xenopus tropicalis


Alignment Length:404 Identity:69/404 - (17%)
Similarity:126/404 - (31%) Gaps:156/404 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 CRQHWIKHLQLLRLLAVIVLASAPVPSHAQQQKFRTTPHDLQVLEGAEAMMRCEVANVAGA---- 101
            |..|       ..::|..:|.|....|.:.:.|..:.|..:..| |::.::...:|....|    
 Frog     3 CNMH-------KTMIAFSILWSLYKGSLSAKYKVVSAPSVVATL-GSDVVLTARLAPEMNAEKME 59

  Fly   102 VQWTKDGFAL----------GFSAVIPGFP-RYSVLGDR-KQGIYNLRISNASINDDADYQCQVG 154
            ::|.|..:..          .::|.:|.|. |..:|.:. .:||:.|.|.|.::.|...|.|.|.
 Frog    60 IRWFKPMYRPYVHLYINGKDDYTAQMPQFANRTELLKENITRGIFPLIIRNVTVQDSGKYYCYVE 124

  Fly   155 PARLNSAIRANAKLTVISPPASIEIKGYS--HNSKVE-VRENQDLQLKCIVANAKPAAQIVWYRG 216
            .:..:.       :|.:.  .::.:.|:|  |:.|.. ||..:|:.:.                 
 Frog   125 SSDHHG-------ITTVY--LNVNVPGHSKTHSHKESGVRIPRDVSIN----------------- 163

  Fly   217 NVEYKPEKREDTVEESTAKRFTTTSSLKLKPGPDDDYTEYTCQARHKALSPDMPMRATVQLSVLY 281
                  ::|:...:.|                                   |.|....|      
 Frog   164 ------QERQSQAQRS-----------------------------------DSPKEGAV------ 181

  Fly   282 PPGPPYIEGYSAGETLRRGQTVELMCRSRGGNPPAQLIWYKN-GSQIRMAYRTSGRLSENIYTFT 345
              |.|.:......:|        :.|.|.|..|...|||..| |:::             |.:..
 Frog   182 --GSPPVISVITDDT--------VFCESDGWYPEPYLIWTDNEGNKV-------------IPSME 223

  Fly   346 AEAGDNKARFRCEASNVMSQNPLKAEVELSVLFAPTHVTVMGPTEARVGDIVPLTCTTAPS-NPP 409
            ....|.|:.:..                ||.::.|       ||.:.:      |||.:.| |..
 Frog   224 KVLKDEKSLYHI----------------LSAIYLP-------PTSSNI------TCTVSSSLNQS 259

  Fly   410 AEIKWMVGGRQVRN 423
            .|....:  |:.|:
 Frog   260 KESSMQI--RETRH 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snsNP_001036532.1 I-set 73..170 CDD:254352 22/112 (20%)
Ig 76..155 CDD:299845 21/94 (22%)
IG_like 186..279 CDD:214653 9/93 (10%)
Ig 197..279 CDD:299845 5/81 (6%)
IG_like 296..376 CDD:214653 14/80 (18%)
Ig 300..361 CDD:299845 12/61 (20%)
Ig 380..454 CDD:299845 11/45 (24%)
IG_like 490..573 CDD:214653
Ig 501..560 CDD:299845
Ig 584..666 CDD:299845
IG_like 585..666 CDD:214653
I-set 678..767 CDD:254352
IGc2 692..757 CDD:197706
Ig 788..849 CDD:143165
Ig 885..960 CDD:143165
FN3 967..1051 CDD:238020
btn2a1XP_012808960.1 Ig 40..138 CDD:386229 20/106 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.