DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sns and lrig3

DIOPT Version :9

Sequence 1:NP_001036532.1 Gene:sns / 44097 FlyBaseID:FBgn0024189 Length:1542 Species:Drosophila melanogaster
Sequence 2:XP_002940426.3 Gene:lrig3 / 100151727 XenbaseID:XB-GENE-1219309 Length:1109 Species:Xenopus tropicalis


Alignment Length:806 Identity:156/806 - (19%)
Similarity:279/806 - (34%) Gaps:207/806 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   267 PDM-PMRATV--------QLSVLYPPGPPYIEGYSAGETLRRGQTVELMCRSRGGNPPAQLIWYK 322
            ||: |:.|.:        ::.|:.   |.:::.|.:.|||....  .|:...|.|:.|.      
 Frog   108 PDLGPLSANITLFSLTNNKIEVIL---PEHLKPYQSLETLDLSN--NLITELRAGSFPT------ 161

  Fly   323 NGSQIRMAYRTSGRLSENIYTFTAEAGDNKARFRCEASNVMSQNPLKAEVELSVLFAPTHVTVMG 387
              .|::..|..:.|:|    |..:.|.||.:    ....|:..|..:.....|.:|..:::..:.
 Frog   162 --LQLKYLYINNNRIS----TMQSGAFDNLS----ATLQVLKLNKNRISYIPSKMFKLSNLQHLE 216

  Fly   388 PTEARVGDIVPLTCTTAPSNPPAEIKWMVGGRQVRNATSKTIVSPEGGWTTTSNITAVVEPNKRS 452
            ....|:.:|:.||.....|.....|:        ||..::.:.....|.:|..    :::.:...
 Frog   217 LNRNRIKEILGLTFQGLDSLKSLRIQ--------RNLITRLMDGAFWGLSTME----ILQLDHNR 269

  Fly   453 LVVICHG--------LNMQLTENVVSTHTINVLYPPAPPLISGYMEGQIIPAGSVQKLLCVSSGG 509
            |..|..|        ..:.|::|.:|:.|     |.|...              .|||..:....
 Frog   270 LTEITKGWLYGLLMLQKLHLSQNAISSIT-----PDAWEF--------------CQKLSELDLAF 315

  Fly   510 NPLATLT------------WYKNDKRINSVIRAADKSVSAEITILANVSDNQAQYRCEASNSATE 562
            |.|..|.            .|..:.:||.:...|.:.:|:..::  ::..|:..:..|..|.   
 Frog   316 NQLTRLEESSFAGLGLLGGLYIGNNKINFIADGAFRGLSSLNSL--DLKSNEISWTIEDMNG--- 375

  Fly   563 IPLFQSTTLSVHFAPETVKIRIEPEELRPGME---ATIICDSSSSNPPAKLSWWKDGIPIEGINN 624
                   |.|                   |:|   ..|:.|:..::...|...|.|.:....:::
 Frog   376 -------TFS-------------------GLERLKRLILQDNRITSITKKAFSWLDALEYLDLSD 414

  Fly   625 TSKPGLWGGTVSTL----EFRVNVTQ---------------EMNGQVYTCQSAN--EALQRSAHE 668
            .:...:.....|.:    :..:|.|.               |...|.:...|..  :.|:..:..
 Frog   415 NAITSMQTNAFSQMKSLQQLYLNTTSLLCDCQLKWLPKWLAESKFQTFVNASCGHPQILKGKSIF 479

  Fly   669 AVSLDVLYRPKFVPPPS-----STAVGVEGESLQ-VSLQTRANPTPVTYKWTKDGTTIPQDGD-- 725
            |||.|......| |.|.     .|...::|.::. :.....::.:|:|:.|.||...: .|.:  
 Frog   480 AVSPDDFVCDDF-PKPQITVQPETQSAIKGSNVTFICSAASSSESPMTFAWKKDNELL-HDSEIE 542

  Fly   726 --HRIFADGGS-LNFTRLHR------DDAGIYSCSASNSQGGA-TLNITVVVEYGTTIKSVSENI 780
              ..:.|.||. :.:|.:.|      .:.|.|.|..||..|.. ::...:.|........:..::
 Frog   543 NYAHLRAQGGEVMEYTTILRLRNVEFINEGKYQCVISNHFGPTYSVKAKLTVNMLPLFTKMPMDL 607

  Fly   781 VVNPGEDAMLSCTVEGKPLTEEHVKWERVGYDMTVKTSTTFANGTSY-------LH--------- 829
            .:..|..|.|.|...|.|..:  :.|::.|             ||.:       :|         
 Frog   608 TIRAGSTARLECAAVGHPTPQ--IAWQKNG-------------GTDFPAARERRMHVMPEDDVFF 657

  Fly   830 IKDAKREDVGNFRCVADNRVDNPTNRDILLIVKFAPEIAKTPTLLR----AASGTGERGRLPCRA 890
            |.:.|.||:|.:.|.|.|...:.:....|.::       :||:.||    ..:..||...|.|.|
 Frog   658 IVNVKTEDIGVYSCTAQNSAGSISANATLTVL-------ETPSFLRPLVDRTASKGETTVLQCIA 715

  Fly   891 QGSPKPQFIWRQDKKDLPINRTYKYEVEERKIDSLTYESTLIVDKVAPADYGAYECVARNELGEA 955
            .|||.|:..|.:|  |.|:      .|.||...:...:..:||| ....|.|.|.|...|.||..
 Frog   716 GGSPTPKVNWTKD--DSPL------VVTERHFFAAGNQHLIIVD-TDLEDAGKYTCEVSNILGTE 771

  Fly   956 VETVRLEITSQPDPPLSLNILNVTHD 981
            ...:.|.:...|.....:|.:....|
 Frog   772 RGNIHLSVLPNPTCDSPVNTIQTAED 797

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snsNP_001036532.1 I-set 73..170 CDD:254352
Ig 76..155 CDD:299845
IG_like 186..279 CDD:214653 4/20 (20%)
Ig 197..279 CDD:299845 4/20 (20%)
IG_like 296..376 CDD:214653 16/79 (20%)
Ig 300..361 CDD:299845 12/60 (20%)
Ig 380..454 CDD:299845 10/73 (14%)
IG_like 490..573 CDD:214653 15/94 (16%)
Ig 501..560 CDD:299845 13/70 (19%)
Ig 584..666 CDD:299845 14/105 (13%)
IG_like 585..666 CDD:214653 14/104 (13%)
I-set 678..767 CDD:254352 22/106 (21%)
IGc2 692..757 CDD:197706 17/76 (22%)
Ig 788..849 CDD:143165 18/76 (24%)
Ig 885..960 CDD:143165 24/74 (32%)
FN3 967..1051 CDD:238020 3/15 (20%)
lrig3XP_002940426.3 LRRNT 40..67 CDD:214470
leucine-rich repeat 52..69 CDD:275380
LRR <58..>243 CDD:227223 32/163 (20%)
internalin_A 70..>437 CDD:380193 69/411 (17%)
leucine-rich repeat 73..93 CDD:275380
leucine-rich repeat 94..140 CDD:275380 7/34 (21%)
leucine-rich repeat 141..163 CDD:275380 7/31 (23%)
leucine-rich repeat 164..187 CDD:275380 7/30 (23%)
leucine-rich repeat 189..211 CDD:275380 4/21 (19%)
leucine-rich repeat 212..235 CDD:275380 4/22 (18%)
leucine-rich repeat 236..259 CDD:275380 4/30 (13%)
leucine-rich repeat 260..283 CDD:275380 3/26 (12%)
leucine-rich repeat 284..307 CDD:275380 6/41 (15%)
leucine-rich repeat 308..331 CDD:275380 4/22 (18%)
leucine-rich repeat 332..355 CDD:275380 4/22 (18%)
leucine-rich repeat 356..380 CDD:275380 5/54 (9%)
leucine-rich repeat 383..406 CDD:275380 4/22 (18%)
leucine-rich repeat 407..428 CDD:275380 1/20 (5%)
PCC 411..>489 CDD:188093 11/77 (14%)
Ig_3 493..580 CDD:404760 17/87 (20%)
Ig strand A 494..497 CDD:409353 1/2 (50%)
Ig strand A' 500..505 CDD:409353 1/4 (25%)
Ig strand B 511..519 CDD:409353 0/7 (0%)
Ig strand C 526..531 CDD:409353 2/4 (50%)
Ig strand C' 533..535 CDD:409353 0/1 (0%)
Ig strand D 552..555 CDD:409353 1/2 (50%)
Ig strand E 559..565 CDD:409353 1/5 (20%)
Ig strand F 572..579 CDD:409353 3/6 (50%)
Ig strand G 586..594 CDD:409353 0/7 (0%)
IgI_LRIG1-like 600..689 CDD:409420 20/103 (19%)
Ig strand B 615..619 CDD:409420 2/3 (67%)
Ig strand C 628..632 CDD:409420 0/5 (0%)
Ig strand E 654..658 CDD:409420 0/3 (0%)
Ig strand F 668..673 CDD:409420 1/4 (25%)
Ig strand G 681..684 CDD:409420 0/2 (0%)
I-set 692..779 CDD:400151 30/95 (32%)
Ig strand A 693..695 CDD:409353 0/1 (0%)
Ig strand A' 700..704 CDD:409353 0/3 (0%)
Ig strand B 707..714 CDD:409353 2/6 (33%)
Ig strand C 721..727 CDD:409353 2/5 (40%)
Ig strand C' 728..730 CDD:409353 1/3 (33%)
Ig strand D 737..740 CDD:409353 1/2 (50%)
Ig strand E 743..751 CDD:409353 1/7 (14%)
Ig strand F 758..766 CDD:409353 3/7 (43%)
Ig strand G 770..779 CDD:409353 1/8 (13%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.