DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sns and cd22

DIOPT Version :9

Sequence 1:NP_001036532.1 Gene:sns / 44097 FlyBaseID:FBgn0024189 Length:1542 Species:Drosophila melanogaster
Sequence 2:XP_017945135.2 Gene:cd22 / 100135351 XenbaseID:XB-GENE-5887760 Length:858 Species:Xenopus tropicalis


Alignment Length:725 Identity:164/725 - (22%)
Similarity:289/725 - (39%) Gaps:164/725 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   182 YSHNSKVEVRENQDLQLKCIVANAKPAAQIV----------WYR-----GNVEYKPEKRED-TVE 230
            |.:.:..:|..:.:.::|..|.....|..||          :||     ||.::..:|... ||.
 Frog    85 YDNKNTKKVDSHFEGRVKPYVGQGNGACGIVLHNVQEGDSGYYRLRTIDGNDQWMTKKNVSLTVS 149

  Fly   231 ESTAKRFTTTSSLKLKP-GPDDDYTEYTCQARHKALSPDMPMRATVQLSVLYPPGPPYIEGYSAG 294
            :|..:       |.::| |...:|.:.|.........||..::.:....|               
 Frog   150 DSGPE-------LMIRPVGVGREYQKLTLSCYVHYYCPDYDIKLSWDGDV--------------- 192

  Fly   295 ETLRRGQTVELMCRSRGGNPPAQLIW-YKNGSQIRMAYRTSGRLSENIYTFTAEAGDNKARFRCE 358
                ||:|...:.|         |.| .:|...|         ::|..:|||....|:....:|.
 Frog   193 ----RGETKTTVPR---------LEWSVRNKKPI---------MTEAEFTFTPTWEDHNKTIQCA 235

  Fly   359 ASNVMSQNPLKAEVELSVLFAPTHVTV---MGPTEARVGDIVPLTCTTAPSNPPAE-IKWMVGGR 419
            .:...|:......|.|::.::|..|.:   ..|.....|:.|.|.||...||||.: .:|.    
 Frog   236 LTKGDSEVTKTGPVVLNIQYSPKGVRIRPETSPVTISKGEEVALECTAESSNPPIDTYRWY---- 296

  Fly   420 QVRNATSKTIVSPEGGWTTTSNITAVVEPNKRSLVVICHGLNMQLTENVVSTH-----TINVLYP 479
                .::..||.....::...:.|...|                 .||.:...     .|||||.
 Frog   297 ----KSANNIVGSNSHYSARESGTYYCE-----------------AENTIGRTRSKGVAINVLYA 340

  Fly   480 PAPPLISGYMEGQIIPAGSVQKLLCVSSGGNP-LATLTWYKNDKRINSVIRAADKSVSAEITILA 543
            |...|   .:..:.|..||...|.| |...|| |..:||||:.::|.:..|..       :|...
 Frog   341 PTVTL---KIPSREIREGSQYTLTC-SVDANPQLVNITWYKDYEKILNKNRDT-------LTFPY 394

  Fly   544 NVSDNQAQYRCEASN-----SATEIPLFQSTTLSVHFAPETVKIRIEPEELRP----GMEATIIC 599
            ........|.|||.|     |:.::      .:.|.:||:..::.:||:  :|    |......|
 Frog   395 IREQESGSYHCEAQNIIGSESSADV------YVDVVYAPKNPEVVVEPK--KPSFVEGSSLRFSC 451

  Fly   600 DSSSSNP-PAKLSWWKDGIPIEGINNTSKPGLWGGTVSTLEFRVNVTQEMNGQVYTCQSANEALQ 663
            :.:|||| .::::|:|:    |.:..:.:....  .:.|::      :|.:|. |.|::.|: :.
 Frog   452 NVNSSNPGVSQITWYKN----EKVMASERKNYI--IIDTIK------EEHHGN-YMCKAGNK-IG 502

  Fly   664 RSAHEAVSLDVLYRPKFVPPPSSTAVGVEGESLQVSLQT-RANPTPVTYKWTKDGTTIPQDGDHR 727
            .::.:|||::|||.||.|.......:..||:.::::... ::|||...::|.||....|    ||
 Frog   503 ATSSQAVSINVLYPPKGVRVTPQAQIITEGDRIRLACSVDKSNPTVTEFRWYKDSALQP----HR 563

  Fly   728 IFADGGSLNFTRLHRDDAGIYSCSASNSQGGATLN-ITVVVEY---GTTIKSVSENIVVNPGEDA 788
                ...:.|..:.|.|:|.|:|.|.|..|..|.. ||:.|:|   |..:.|:..|:|....: .
 Frog   564 ----NKEITFPGIKRTDSGKYTCEARNGIGNVTSQPITLNVQYAPVGVMVSSIPSNLVTEHTK-V 623

  Fly   789 MLSCTVEGKPLTEEHVKWERVGYDMTVKTSTTFANGTSYLHIKDAKREDVGNFRCVADNRVDNPT 853
            .|:||.:..|.|..:..::.   .:.:|.|.:..  ..|:.:.|.     |.:.|:|.|.:.:.|
 Frog   624 TLTCTAQAYPNTISYAIYKD---GVLLKYSQSLV--LDYIQLSDG-----GEYYCMATNSIGSGT 678

  Fly   854 NRDILLIVKF 863
            :|.|.:.|.:
 Frog   679 SRTIDIHVSY 688

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snsNP_001036532.1 I-set 73..170 CDD:254352
Ig 76..155 CDD:299845
IG_like 186..279 CDD:214653 21/109 (19%)
Ig 197..279 CDD:299845 20/98 (20%)
IG_like 296..376 CDD:214653 17/80 (21%)
Ig 300..361 CDD:299845 13/61 (21%)
Ig 380..454 CDD:299845 17/77 (22%)
IG_like 490..573 CDD:214653 22/88 (25%)
Ig 501..560 CDD:299845 18/64 (28%)
Ig 584..666 CDD:299845 18/86 (21%)
IG_like 585..666 CDD:214653 18/85 (21%)
I-set 678..767 CDD:254352 26/90 (29%)
IGc2 692..757 CDD:197706 19/65 (29%)
Ig 788..849 CDD:143165 13/60 (22%)
Ig 885..960 CDD:143165
FN3 967..1051 CDD:238020
cd22XP_017945135.2 Ig 35..149 CDD:416386 13/63 (21%)
FR1 35..55 CDD:409353
Ig strand A' 40..44 CDD:409353
Ig strand B 46..56 CDD:409353
CDR1 56..62 CDD:409353
Ig strand C 62..69 CDD:409353
FR2 63..69 CDD:409353
CDR2 70..99 CDD:409353 2/13 (15%)
Ig strand C1 71..74 CDD:409353
Ig strand C2 77..81 CDD:409353
Ig strand C' 85..88 CDD:409353 1/2 (50%)
FR3 100..133 CDD:409353 7/32 (22%)
Ig strand D 101..105 CDD:409353 1/3 (33%)
Ig strand E 110..118 CDD:409353 3/7 (43%)
Ig strand F 125..133 CDD:409353 2/7 (29%)
CDR3 134..136 CDD:409353 1/1 (100%)
FR4 137..149 CDD:409353 2/11 (18%)
Ig strand G 137..149 CDD:409353 2/11 (18%)
Ig 164..253 CDD:416386 22/125 (18%)
Ig strand B 168..176 CDD:409353 1/7 (14%)
Ig strand C 184..190 CDD:409353 0/5 (0%)
Ig strand C' 192..195 CDD:409353 2/21 (10%)
Ig strand D 200..206 CDD:409353 2/14 (14%)
Ig strand E 213..222 CDD:409353 3/17 (18%)
Ig strand F 230..238 CDD:409353 1/7 (14%)
Ig strand G 243..251 CDD:409353 1/7 (14%)
Ig 257..339 CDD:416386 22/106 (21%)
Ig strand A 257..265 CDD:409353 2/7 (29%)
Ig strand A' 269..273 CDD:409353 0/3 (0%)
Ig strand B 274..284 CDD:409353 5/9 (56%)
Ig strand C 291..297 CDD:409353 1/13 (8%)
Ig strand C' 299..302 CDD:409353 0/2 (0%)
Ig strand F 315..323 CDD:409353 2/24 (8%)
Ig strand G 326..339 CDD:409353 3/12 (25%)
Ig 341..425 CDD:416386 25/100 (25%)
Ig strand A 341..347 CDD:409353 2/8 (25%)
Ig strand A' 351..354 CDD:409353 1/2 (50%)
Ig strand B 355..365 CDD:409353 5/10 (50%)
Ig strand C 371..377 CDD:409353 2/5 (40%)
Ig strand C' 379..382 CDD:409353 0/2 (0%)
Ig strand E 388..394 CDD:409353 1/12 (8%)
Ig strand F 401..409 CDD:409353 4/7 (57%)
Ig strand G 412..425 CDD:409353 2/18 (11%)
Ig_3 430..499 CDD:404760 17/83 (20%)
Ig strand A 430..433 CDD:409353 0/2 (0%)
Ig strand A' 438..442 CDD:409353 1/3 (33%)
Ig strand B 445..454 CDD:409353 1/8 (13%)
Ig strand E 478..484 CDD:409353 0/7 (0%)
Ig strand F 491..499 CDD:409353 3/8 (38%)
Ig strand G 504..513 CDD:409353 3/8 (38%)
Ig 516..602 CDD:416386 27/93 (29%)
Ig strand A 516..523 CDD:409353 3/6 (50%)
Ig strand A' 527..531 CDD:409353 0/3 (0%)
Ig strand B 532..542 CDD:409353 1/9 (11%)
Ig strand C 549..555 CDD:409353 1/5 (20%)
Ig strand E 565..571 CDD:409353 1/5 (20%)
Ig strand F 578..586 CDD:409353 4/7 (57%)
Ig strand G 589..602 CDD:409353 5/12 (42%)
Ig_2 617..683 CDD:404734 16/76 (21%)
Ig strand B 623..627 CDD:409353 1/3 (33%)
Ig strand C 635..641 CDD:409353 1/5 (20%)
Ig strand E 651..655 CDD:409353 0/5 (0%)
Ig strand F 665..670 CDD:409353 1/4 (25%)
Ig strand G 679..682 CDD:409353 1/2 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.