DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sns and jam2b

DIOPT Version :9

Sequence 1:NP_001036532.1 Gene:sns / 44097 FlyBaseID:FBgn0024189 Length:1542 Species:Drosophila melanogaster
Sequence 2:NP_001121766.1 Gene:jam2b / 100005301 ZFINID:ZDB-GENE-080229-3 Length:306 Species:Danio rerio


Alignment Length:294 Identity:74/294 - (25%)
Similarity:116/294 - (39%) Gaps:66/294 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   577 PETVKIRIEPEELRPGMEATIICD---SSSSNPPAKLSWWKDG-----IPIEGINNTSKPGLWGG 633
            |.||.......::.....|.:.|:   ...:||  ::.|.|.|     :..||....|..|....
Zfish    32 PVTVTTSKAKMDVHENTNAVLSCEFRTEKETNP--RVEWKKRGKDVSYVYFEGDFTGSYKGRASI 94

  Fly   634 TVSTLEFRVNVTQEMNGQVYTCQ-SANEALQRSAHEAVSLDVLYRPKFVPPPSST-----AVGVE 692
            ..:||..| .|||:.:| ||.|: :|.:...:....:|:|.||     |||.:.|     || :.
Zfish    95 DGATLTLR-GVTQKDSG-VYHCEVTARQDKIKLGEVSVTLSVL-----VPPHAPTCEVPEAV-MR 151

  Fly   693 GESLQVSLQTRANPTPVTYKWTKD----GTTIPQDGDHRIFADGGSLNFTRLHRDDAGIYSCSAS 753
            |.|.::..:.:.:....||.|.||    .|..|.|..:.:....|||.|..:.:.|.|.|.|.||
Zfish   152 GFSAELHCKDKLSVPAATYSWYKDNKPLNTANPHDVHYTLDTKTGSLKFKSVSKSDEGQYRCEAS 216

  Fly   754 NSQGGA-------------TLNITVV--VEYGTTIKSVSENIVVNPGEDAMLSCTVEG-----KP 798
            |..|..             .||:|::  :|.|..:..||..:       ::..|...|     :.
Zfish   217 NGVGAPKSCAGHHMKITEFELNMTMIIAIEVGAFLLLVSCCV-------SICLCCRRGCCHCCRR 274

  Fly   799 LTEEHVKWERVGYDMTVKTSTTFANGTS---YLH 829
            .::|.:|..        ||.|::...|.   |.|
Zfish   275 QSKEEIKQS--------KTKTSYNQPTDPRRYKH 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snsNP_001036532.1 I-set 73..170 CDD:254352
Ig 76..155 CDD:299845
IG_like 186..279 CDD:214653
Ig 197..279 CDD:299845
IG_like 296..376 CDD:214653
Ig 300..361 CDD:299845
Ig 380..454 CDD:299845
IG_like 490..573 CDD:214653
Ig 501..560 CDD:299845
Ig 584..666 CDD:299845 22/90 (24%)
IG_like 585..666 CDD:214653 22/89 (25%)
I-set 678..767 CDD:254352 31/112 (28%)
IGc2 692..757 CDD:197706 21/68 (31%)
Ig 788..849 CDD:143165 10/50 (20%)
Ig 885..960 CDD:143165
FN3 967..1051 CDD:238020
jam2bNP_001121766.1 Ig 44..135 CDD:299845 24/94 (26%)
IG_like 44..134 CDD:214653 24/93 (26%)
IGc2 154..220 CDD:197706 20/65 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.