DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sns and si:ch211-286b5.8

DIOPT Version :9

Sequence 1:NP_001036532.1 Gene:sns / 44097 FlyBaseID:FBgn0024189 Length:1542 Species:Drosophila melanogaster
Sequence 2:XP_017212152.1 Gene:si:ch211-286b5.8 / 100003760 ZFINID:ZDB-GENE-121214-73 Length:357 Species:Danio rerio


Alignment Length:210 Identity:54/210 - (25%)
Similarity:99/210 - (47%) Gaps:29/210 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   582 IRIE-PEELRPGMEATIICDSSSSNPPAKLSWWKDGIPIEGINNTSKPGLWGGTVSTLEFRVNVT 645
            :|:| |.|:..|....:.|.||.:...:..||:::|   |..:.:.:.       :.|..: :|:
Zfish    92 LRVETPAEVVEGDSPVLTCKSSCNLGSSIFSWYRNG---ESFSESVRQ-------NQLILQ-SVS 145

  Fly   646 QEMNGQVYTCQSANEALQRSAHEAVSLDVLYRPKFVP-PPSSTAVGVEGESLQVSLQTRANPTPV 709
            :|.:|. |:|  |...|:.....|::|:|.|.||.|. ..|.:||.|.|:|:.:|..:.:||..:
Zfish   146 REDSGN-YSC--AVRDLKNLPSPALTLNVRYPPKSVSVSVSGSAVIVSGDSVTLSCSSDSNPPAL 207

  Fly   710 TYKWTKDGTTIPQDGDHRIFADGGSLNFTRLHRDDAGIYSCSASNSQGG-ATLNITVVVEYGTTI 773
            .:.|.|:..::       ....|.|.:.:..:...:|.|.|.|.|..|. .:.:|:|.||     
Zfish   208 NFTWFKENQSL-------AVGSGQSFSISSFNSSHSGRYYCKAHNKYGSQRSESISVTVE----- 260

  Fly   774 KSVSENIVVNPGEDA 788
            :|.|..:::..|..|
Zfish   261 ESSSSWVLITAGVTA 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snsNP_001036532.1 I-set 73..170 CDD:254352
Ig 76..155 CDD:299845
IG_like 186..279 CDD:214653
Ig 197..279 CDD:299845
IG_like 296..376 CDD:214653
Ig 300..361 CDD:299845
Ig 380..454 CDD:299845
IG_like 490..573 CDD:214653
Ig 501..560 CDD:299845
Ig 584..666 CDD:299845 19/82 (23%)
IG_like 585..666 CDD:214653 19/81 (23%)
I-set 678..767 CDD:254352 24/90 (27%)
IGc2 692..757 CDD:197706 14/64 (22%)
Ig 788..849 CDD:143165 1/1 (100%)
Ig 885..960 CDD:143165
FN3 967..1051 CDD:238020
si:ch211-286b5.8XP_017212152.1 IG_like <36..89 CDD:214653
ig 94..158 CDD:278476 18/77 (23%)
IG_like 99..171 CDD:214653 19/85 (22%)
Ig_2 191..255 CDD:290606 15/70 (21%)
IG_like 191..253 CDD:214653 15/68 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.