DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wit and AT3G45410

DIOPT Version :9

Sequence 1:NP_001261395.1 Gene:wit / 44096 FlyBaseID:FBgn0024179 Length:913 Species:Drosophila melanogaster
Sequence 2:NP_190127.1 Gene:AT3G45410 / 823679 AraportID:AT3G45410 Length:664 Species:Arabidopsis thaliana


Alignment Length:303 Identity:81/303 - (26%)
Similarity:120/303 - (39%) Gaps:70/303 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 KQHQSFLASTMLGLAGGLTALTIGIFLAVQYCRTAK--EKPEPEESPLAPSGPGYSSNLRNVDNM 224
            |:.:..|:..::||...|....:.:...|.:.|..|  |..|..|....|....|.|..:..:..
plant   278 KEEKKKLSPLLIGLVILLVIPVVMVLGGVYWYRRKKYAEVKEWWEKEYGPHRFSYKSLYKATNGF 342

  Fly   225 NLIGMLGSGKYGTVMKGLL------------HDQEVAVKIYPEE-------HHQYYVNERNIYAL 270
            .....:|.|.:|.|.||.|            ||.|..:|.:..|       .|      ||:  :
plant   343 RKDCRVGKGGFGEVYKGTLPGGRHIAVKRLSHDAEQGMKQFVAEVVTMGNLQH------RNL--V 399

  Fly   271 PLMECPALLSYFGYDERCTMDGRMEYQLVLSLAPLGCLQDWLIAN---TLTFSECCGMLRSITRG 332
            ||:         ||..|     :.|..||....|.|.|..:|...   :.::.:...:|:.|...
plant   400 PLL---------GYCRR-----KCELLLVSEYMPNGSLDQYLFHEGNPSPSWYQRISILKDIASA 450

  Fly   333 ISHLHTELRLGDQHKPCVAHRDINTRNVLVQADLSCCIADFGFALKVFGSKYEYKGEVAMAETKS 397
            :|:|||..      |..|.||||...||::.::.:..:.|||.|      |:..:|    ....:
plant   451 LSYLHTGT------KQVVLHRDIKASNVMLDSEFNGRLGDFGMA------KFHDRG----TNLSA 499

  Fly   398 INEVGTLRYMAPELLEGAVNLRDCETSLKQMDVYALGLVLWEV 440
            ...|||:.||||||:       ...||:| .||||.|..|.||
plant   500 TAAVGTIGYMAPELI-------TMGTSMK-TDVYAFGAFLLEV 534

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
witNP_001261395.1 snake_toxin 57..133 CDD:264434
STYKc 226..517 CDD:214568 67/237 (28%)
STKc_BMPR2_AMHR2 228..528 CDD:270956 67/235 (29%)
AT3G45410NP_190127.1 Lectin_legB 27..272 CDD:278564
STKc_IRAK 348..612 CDD:270968 67/233 (29%)
STYKc 349..610 CDD:214568 67/232 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.