DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wit and AT2G19210

DIOPT Version :9

Sequence 1:NP_001261395.1 Gene:wit / 44096 FlyBaseID:FBgn0024179 Length:913 Species:Drosophila melanogaster
Sequence 2:NP_179511.1 Gene:AT2G19210 / 816438 AraportID:AT2G19210 Length:881 Species:Arabidopsis thaliana


Alignment Length:300 Identity:75/300 - (25%)
Similarity:122/300 - (40%) Gaps:75/300 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 LASTMLGLAGGLTALTIGIFLAVQYCRTAKEKPEPEESPLAPSGP--------GYSSNLRNVDNM 224
            |.::::|:.|  ..|.|.:||..      |::.....|....:||        .||..::..:|.
plant   522 LVASVVGVLG--LVLAIALFLLY------KKRHRRGGSGGVRAGPLDTTKRYYKYSEVVKVTNNF 578

  Fly   225 NLIGMLGSGKYGTVMKGLLHDQEVAVKIYPEEHHQYY------------VNERNIYALPLMECPA 277
            ..:  ||.|.:|.|..|:|:|.:|||||..|...|.|            |:.:|:.||       
plant   579 ERV--LGQGGFGKVYHGVLNDDQVAVKILSESSAQGYKEFRAEVELLLRVHHKNLTAL------- 634

  Fly   278 LLSYFGYDERCTMDGRMEYQLVLSLAPLGCLQDWLIAN---TLTFSECCGMLRSITRGISHLHTE 339
                .||   |....:|  .|:......|.|.|:|...   .|::.|...:.....:|:.:||..
plant   635 ----IGY---CHEGKKM--ALIYEFMANGTLGDYLSGEKSYVLSWEERLQISLDAAQGLEYLHNG 690

  Fly   340 LRLGDQHKPCVAHRDINTRNVLVQADLSCCIADFGFALKVF--GSKYEYKGEVAMAETKSINEVG 402
            .      ||.:..||:...|:|:...|...|||||.:..|.  |:.         .:|.::  .|
plant   691 C------KPPIVQRDVKPANILINEKLQAKIADFGLSRSVALDGNN---------QDTTAV--AG 738

  Fly   403 TLRYMAPELLEGAVNLRDCETSLKQMDVYALGLVLWEVAT 442
            |:.|:.||       ....:...::.|:|:.|:||.||.:
plant   739 TIGYLDPE-------YHLTQKLSEKSDIYSFGVVLLEVVS 771

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
witNP_001261395.1 snake_toxin 57..133 CDD:264434
STYKc 226..517 CDD:214568 61/233 (26%)
STKc_BMPR2_AMHR2 228..528 CDD:270956 61/231 (26%)
AT2G19210NP_179511.1 Malectin_like 34..357 CDD:289580
leucine-rich repeat 415..438 CDD:275380
LRR_8 417..473 CDD:290566
leucine-rich repeat 439..462 CDD:275380
leucine-rich repeat 463..488 CDD:275380
STKc_IRAK 582..848 CDD:270968 61/229 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.