DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fus and Hnrnph1

DIOPT Version :9

Sequence 1:NP_524691.1 Gene:fus / 44095 FlyBaseID:FBgn0023441 Length:967 Species:Drosophila melanogaster
Sequence 2:NP_001334416.1 Gene:Hnrnph1 / 59013 MGIID:1891925 Length:472 Species:Mus musculus


Alignment Length:523 Identity:125/523 - (23%)
Similarity:209/523 - (39%) Gaps:129/523 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   280 IVRARGLPWQSSDQDIAKFFRGLNVAKG--GVALCLSPLGRRNGEALIRFVCQEHRDMALKRHKH 342
            :|:.|||||..|..::.:||....:..|  |:....:..||.:|||.:....::...:|||:.:.
Mouse    12 VVKVRGLPWSCSADEVQRFFSDCKIQNGAQGIRFIYTREGRPSGEAFVELESEDEVKLALKKDRE 76

  Fly   343 HIGTRYIEVYRASGEDFLAIAGGASNEAQAFLSKGAQVIIRMRGLPYDATAKQVLDFFTTGDTPP 407
            .:|.||:||::::..:...:.......:....:.|   .:|:||||:..:.::::.||:..:..|
Mouse    77 TMGHRYVEVFKSNNVEMDWVLKHTGPNSPDTANDG---FVRLRGLPFGCSKEEIVQFFSGLEIVP 138

  Fly   408 CHVLDGNEGVLFVKKPDGRATGDAFVLFANETDAPKALGRHRESIGQRYIELFRSTTAEVQQVLN 472
                   .|:.......||:||:|||.||::..|.|||.:|:|.||.||||:|:|:.|||:.   
Mouse   139 -------NGITLPVDFQGRSTGEAFVQFASQEIAEKALKKHKERIGHRYIEIFKSSRAEVRT--- 193

  Fly   473 RSMDPKNYESGGGHSQPPLIAQLPTMQLP-LLPQVGAHSLSHSLGASPA---------------- 520
                         |..||  .:|..||.| ...:.||....:|:|....                
Mouse   194 -------------HYDPP--RKLMAMQRPGPYDRPGAGRGYNSIGRGAGFERMRRGAYGGGYGGY 243

  Fly   521 ---------------------NLCPPVPPPALPLPTQHLITSG------TTKNCIRLRGLPYEAM 558
                                 |.|       ....:.|....|      ||.:|:.:|||||.|.
Mouse   244 DDYNGYNDGYGFGSDRFGRDLNYC-------FSGMSDHRYGDGGSTFQSTTGHCVHMRGLPYRAT 301

  Fly   559 VEHILHFLDDFAKHIIYQGVHMVINAQGQPSGEAFIQMDLEESARLCAQRRHNHYMMFGKKYRYI 623
            ...|.:|......    ..||:.|...|:.:|||.::....|.| :.|..:....|    ::||:
Mouse   302 ENDIYNFFSPLNP----VRVHIEIGPDGRVTGEADVEFATHEDA-VAAMSKDKANM----QHRYV 357

  Fly   624 EVFQCSGDDMNMV--LNGGLASPVAQPPPPHLGHAHKQQSL-LAATTG---------MFSSAGQS 676
            |:|      :|..  .:||             .:.|:...| |.:|.|         |....|.|
Mouse   358 ELF------LNSTAGASGG-------------AYEHRYVELFLNSTAGASGGAYGSQMMGGMGLS 403

  Fly   677 PTTVAAGTAQSPLGGTHTHTHPHSHAHAHATGHAHAAAAAAHHGLSASSAM-----LPGLSAAAS 736
            ..:...|.|...|.|.:...:   ...:..:|:....|..:.:..:.|.|.     :.|:|:.:|
Mouse   404 NQSSYGGPASQQLSGGYGGGY---GGQSSMSGYGSQGAVNSSYYSNGSRASMGVNGMGGMSSMSS 465

  Fly   737 ASG 739
            .||
Mouse   466 MSG 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fusNP_524691.1 DnaQ_like_exo 13..194 CDD:299142
RRM1_Fusilli 280..359 CDD:241182 24/80 (30%)
RRM2_Fusilli 363..462 CDD:241185 32/98 (33%)
RRM3_Fusilli 545..629 CDD:241187 24/83 (29%)
Hnrnph1NP_001334416.1 RRM1_hnRNPH_hnRNPH2_hnRNPF 10..88 CDD:410128 24/75 (32%)
RRM2_hnRNPH_hnRNPH2_hnRNPF 103..192 CDD:410130 35/98 (36%)
2 X 16 AA Gly-rich approximate repeats 234..433 45/236 (19%)
zf-RNPHF 255..290 CDD:369688 6/41 (15%)
RRM3_hnRNPH_hnRNPH2_hnRNPF 289..364 CDD:410133 25/89 (28%)
2 X 19 AA perfect repeats 354..392 12/56 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4211
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D392876at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.