DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fus and Hnrnph3

DIOPT Version :9

Sequence 1:NP_524691.1 Gene:fus / 44095 FlyBaseID:FBgn0023441 Length:967 Species:Drosophila melanogaster
Sequence 2:NP_001073293.1 Gene:Hnrnph3 / 432467 MGIID:1926462 Length:346 Species:Mus musculus


Alignment Length:274 Identity:71/274 - (25%)
Similarity:106/274 - (38%) Gaps:95/274 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   272 DDEVDGNCIVRARGLPWQSSDQDIAKFFRGLNVAKGGVALCLSPLGRRNGEALIRFVCQEHRDMA 336
            :|..||.  ||.||||:..|.::|.:||:||.:...|:.|.:...||..|||.::|..:|..:.|
Mouse    11 NDASDGT--VRLRGLPFGCSKEEIVQFFQGLEIVPNGITLTMDYQGRSTGEAFVQFASKEIAENA 73

  Fly   337 LKRHKHHIGTRYIEVYRASGEDFLAI--------------------------------------- 362
            |.:||..||.||||::|:|..:....                                       
Mouse    74 LGKHKERIGHRYIEIFRSSRSEIKGFYDPPRRLLGQRPGPYDRPIGGRGGYYGAGRGSMYDRMRR 138

  Fly   363 ------------------------------------------AGGASNEAQAFLSKGAQVIIRMR 385
                                                      .|||.:.:..|  .|.. .:.||
Mouse   139 GGDGYDGGYGGFDDYGGYNNYGYGNDGFDDRMRDGRGMGGHGYGGAGDASSGF--HGGH-FVHMR 200

  Fly   386 GLPYDATAKQVLDFFTTGDTPPCHVLDGNEGVLFVKKPDGRATGDAFVLFANETDAPKALGRHRE 450
            |||:.||...:.:||:..:....|:..|         .||||||:|.|.|....||..|:.:.:.
Mouse   201 GLPFRATENDIANFFSPLNPIRVHIDIG---------ADGRATGEADVEFVTHEDAVAAMSKDKN 256

  Fly   451 SIGQRYIELFRSTT 464
            ::..||||||.::|
Mouse   257 NMQHRYIELFLNST 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fusNP_524691.1 DnaQ_like_exo 13..194 CDD:299142
RRM1_Fusilli 280..359 CDD:241182 33/78 (42%)
RRM2_Fusilli 363..462 CDD:241185 34/98 (35%)
RRM3_Fusilli 545..629 CDD:241187
Hnrnph3NP_001073293.1 RRM2_hnRNPH3 1..93 CDD:410131 35/83 (42%)
RRM3_hnRNPH3 195..269 CDD:241179 29/83 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167845688
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4211
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D392876at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.