Sequence 1: | NP_524691.1 | Gene: | fus / 44095 | FlyBaseID: | FBgn0023441 | Length: | 967 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001073293.1 | Gene: | Hnrnph3 / 432467 | MGIID: | 1926462 | Length: | 346 | Species: | Mus musculus |
Alignment Length: | 274 | Identity: | 71/274 - (25%) |
---|---|---|---|
Similarity: | 106/274 - (38%) | Gaps: | 95/274 - (34%) |
- Green bases have known domain annotations that are detailed below.
Fly 272 DDEVDGNCIVRARGLPWQSSDQDIAKFFRGLNVAKGGVALCLSPLGRRNGEALIRFVCQEHRDMA 336
Fly 337 LKRHKHHIGTRYIEVYRASGEDFLAI--------------------------------------- 362
Fly 363 ------------------------------------------AGGASNEAQAFLSKGAQVIIRMR 385
Fly 386 GLPYDATAKQVLDFFTTGDTPPCHVLDGNEGVLFVKKPDGRATGDAFVLFANETDAPKALGRHRE 450
Fly 451 SIGQRYIELFRSTT 464 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
fus | NP_524691.1 | DnaQ_like_exo | 13..194 | CDD:299142 | |
RRM1_Fusilli | 280..359 | CDD:241182 | 33/78 (42%) | ||
RRM2_Fusilli | 363..462 | CDD:241185 | 34/98 (35%) | ||
RRM3_Fusilli | 545..629 | CDD:241187 | |||
Hnrnph3 | NP_001073293.1 | RRM2_hnRNPH3 | 1..93 | CDD:410131 | 35/83 (42%) |
RRM3_hnRNPH3 | 195..269 | CDD:241179 | 29/83 (35%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167845688 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG4211 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D392876at33208 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.750 |