DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fus and Hnrnph3

DIOPT Version :9

Sequence 1:NP_524691.1 Gene:fus / 44095 FlyBaseID:FBgn0023441 Length:967 Species:Drosophila melanogaster
Sequence 2:NP_001102002.1 Gene:Hnrnph3 / 361838 RGDID:1310019 Length:346 Species:Rattus norvegicus


Alignment Length:274 Identity:71/274 - (25%)
Similarity:106/274 - (38%) Gaps:95/274 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   272 DDEVDGNCIVRARGLPWQSSDQDIAKFFRGLNVAKGGVALCLSPLGRRNGEALIRFVCQEHRDMA 336
            :|..||.  ||.||||:..|.::|.:||:||.:...|:.|.:...||..|||.::|..:|..:.|
  Rat    11 NDASDGT--VRLRGLPFGCSKEEIVQFFQGLEIVPNGITLTMDYQGRSTGEAFVQFASKEIAENA 73

  Fly   337 LKRHKHHIGTRYIEVYRASGEDFLAI--------------------------------------- 362
            |.:||..||.||||::|:|..:....                                       
  Rat    74 LGKHKERIGHRYIEIFRSSRSEIKGFYDPPRRLLGQRPGPYDRPIGGRGGYYGAGRGSMYDRMRR 138

  Fly   363 ------------------------------------------AGGASNEAQAFLSKGAQVIIRMR 385
                                                      .|||.:.:..|  .|.. .:.||
  Rat   139 GGDGYDGGYGGFDDYGGYNNYGYGNDGFDDRMRDGRGMGGHGYGGAGDASSGF--HGGH-FVHMR 200

  Fly   386 GLPYDATAKQVLDFFTTGDTPPCHVLDGNEGVLFVKKPDGRATGDAFVLFANETDAPKALGRHRE 450
            |||:.||...:.:||:..:....|:..|         .||||||:|.|.|....||..|:.:.:.
  Rat   201 GLPFRATENDIANFFSPLNPIRVHIDIG---------ADGRATGEADVEFVTHEDAVAAMSKDKN 256

  Fly   451 SIGQRYIELFRSTT 464
            ::..||||||.::|
  Rat   257 NMQHRYIELFLNST 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fusNP_524691.1 DnaQ_like_exo 13..194 CDD:299142
RRM1_Fusilli 280..359 CDD:241182 33/78 (42%)
RRM2_Fusilli 363..462 CDD:241185 34/98 (35%)
RRM3_Fusilli 545..629 CDD:241187
Hnrnph3NP_001102002.1 RRM2_hnRNPH3 1..93 CDD:410131 35/83 (42%)
RRM3_hnRNPH3 195..269 CDD:241179 29/83 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166349092
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4211
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D392876at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.