DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fus and HNRNPF

DIOPT Version :9

Sequence 1:NP_524691.1 Gene:fus / 44095 FlyBaseID:FBgn0023441 Length:967 Species:Drosophila melanogaster
Sequence 2:NP_001091674.1 Gene:HNRNPF / 3185 HGNCID:5039 Length:415 Species:Homo sapiens


Alignment Length:455 Identity:125/455 - (27%)
Similarity:199/455 - (43%) Gaps:96/455 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   280 IVRARGLPWQSSDQDIAKFFRGLNVAKG--GVALCLSPLGRRNGEALIRFVCQEHRDMALKRHKH 342
            :|:.|||||..|.:|:..|.....:..|  ||....:..||::|||.:....::...||||:.:.
Human    12 VVKLRGLPWSCSVEDVQNFLSDCTIHDGAAGVHFIYTREGRQSGEAFVELGSEDDVKMALKKDRE 76

  Fly   343 HIGTRYIEVYRA--SGEDFLAIAGGASNEAQAFLSKGAQVIIRMRGLPYDATAKQVLDFFTTGDT 405
            .:|.|||||:::  :..|::....|.::...|  :.|   .:|:||||:..|.::::.||:..:.
Human    77 SMGHRYIEVFKSHRTEMDWVLKHSGPNSADSA--NDG---FVRLRGLPFGCTKEEIVQFFSGLEI 136

  Fly   406 PPCHVLDGNEGVLFVKKPDGRATGDAFVLFANETDAPKALGRHRESIGQRYIELFRSTTAEV--- 467
            .|       .|:.....|:|:.||:|||.||::..|.||||:|:|.||.||||:|:|:..||   
Human   137 VP-------NGITLPVDPEGKITGEAFVQFASQELAEKALGKHKERIGHRYIEVFKSSQEEVRSY 194

  Fly   468 ------------------------------QQVLNRSMDPKNYESG-GGHSQPPLIAQLPTMQLP 501
                                          |..|.| |.|..|.:| ||:.:...::........
Human   195 SDPPLKFMSVQRPGPYDRPGTARRYIGIVKQAGLER-MRPGAYSTGYGGYEEYSGLSDGYGFTTD 258

  Fly   502 LLPQVGAHSLS----HSLGASPANLCPPVPPPALPLPTQHLITSGTTKNCIRLRGLPYEAMVEHI 562
            |..:..::.||    |..|.|                  ......||.:|:.:|||||:|....|
Human   259 LFGRDLSYCLSGMYDHRYGDS------------------EFTVQSTTGHCVHMRGLPYKATENDI 305

  Fly   563 LHFLDDFAKHIIYQGVHMVINAQGQPSGEAFIQMDL-EESARLCAQRRHNHYMMFGKKYRYIEVF 626
            .:|......    ..||:.|...|:.:|||.::... ||:....::.|.|      .::||||:|
Human   306 YNFFSPLNP----VRVHIEIGPDGRVTGEADVEFATHEEAVAAMSKDRAN------MQHRYIELF 360

  Fly   627 QCSGDDMNMVLNGGLASPVAQPPPPHLGHAHKQQSLLAATTGMFSSAGQSPTTVAAGTAQSPLGG 691
            ..|....:   ||..:|.|.|    .:|.:..|     ||.....|...|....|..:.|:.:||
Human   361 LNSTTGAS---NGAYSSQVMQ----GMGVSAAQ-----ATYSGLESQSVSGCYGAGYSGQNSMGG 413

  Fly   692  691
            Human   414  413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fusNP_524691.1 DnaQ_like_exo 13..194 CDD:299142
RRM1_Fusilli 280..359 CDD:241182 27/82 (33%)
RRM2_Fusilli 363..462 CDD:241185 36/98 (37%)
RRM3_Fusilli 545..629 CDD:241187 25/84 (30%)
HNRNPFNP_001091674.1 RRM1_hnRNPH_hnRNPH2_hnRNPF 10..88 CDD:410128 27/75 (36%)
Interaction with RNA 81..86 4/4 (100%)
RRM2_hnRNPH_hnRNPH2_hnRNPF 103..192 CDD:410130 37/100 (37%)
Interaction with RNA 179..184 4/4 (100%)
zf-RNPHF 255..290 CDD:369688 8/52 (15%)
RRM3_hnRNPH_CRSF1_like 289..363 CDD:409929 25/83 (30%)
Interaction with RNA 355..360 4/4 (100%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165155213
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4211
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D392876at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.