DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rs1 and CG7483

DIOPT Version :9

Sequence 1:NP_001286188.1 Gene:Rs1 / 44087 FlyBaseID:FBgn0021995 Length:782 Species:Drosophila melanogaster
Sequence 2:NP_649788.2 Gene:CG7483 / 40987 FlyBaseID:FBgn0037573 Length:399 Species:Drosophila melanogaster


Alignment Length:396 Identity:125/396 - (31%)
Similarity:206/396 - (52%) Gaps:24/396 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 KKKAGEEDEEDEGEKMQFADTVEANEQITSFYQMNLSRPLMRAIGVLGYIYPTPIQASTIPVALL 193
            :|.|..||..:    ::| :|.|..|.|.:|..|||...|:|.|...|:..|:.||..:|...:.
  Fly     3 RKNAQAEDLSN----VEF-ETSEDVEVIPTFNAMNLKEELLRGIYAYGFEKPSAIQQRSITPIVK 62

  Fly   194 GRDICGCAATGTGKTAAYMLPTLERLLYRPLNNKAI--TRVLVLVPTRELGAQVYQVTKQLCQFT 256
            |||:...|.:||||||.:.:..|:.|      :..:  |:||.|.|||||..|:.:|...|....
  Fly    63 GRDVIAQAQSGTGKTATFSISILQSL------DTTLRETQVLCLSPTRELAVQIQKVILALGDMM 121

  Fly   257 TIDVGLAIGGLDVKAQEAVLRQNPDIVIATPGRLIDHIKNTPSFTLDSIEVLILDEADRMLDEYF 321
            .:...:.|||.::......|.....||..||||:.|.||.....| .:|::|:|||||.||::.|
  Fly   122 NVQCHVCIGGTNLGEDIRKLDYGQHIVSGTPGRVFDMIKRRVLRT-RAIKMLVLDEADEMLNKGF 185

  Fly   322 AEQMKEIINSCCKTRQTMLFSATMSEQVKDLAAVSLDKPIKVFVNNNQQVAFNLRQEFIRIREDK 386
            .||:.::........|.:|.|||:..::.::.:..:..||::.|..::.....::|.|:.:    
  Fly   186 KEQIYDVYRYLPPATQVVLISATLPHEILEMTSKFMTDPIRILVKRDELTLEGIKQFFVAV---- 246

  Fly   387 EGDREPILASLICRTFH----DHCMVFVQTKKQAHRLHILLGLLGVRAGELHGNLTQQQRLESLK 447
              :||......:|..:.    ...::|..||::...|...:.........:||::.|::|.|.:|
  Fly   247 --EREEWKFDTLCDLYDTLTITQAVIFCNTKRKVDWLTEKMREANFTVSSMHGDMPQKERDEIMK 309

  Fly   448 KFKEEQIDVLIATDVAARGLDIVGVKTVINFVMPITTEHYIHRVGRTARAGRAGISVSLAGEKER 512
            :|:..|..|||.|||.|||:|:..|..|||:.:|...|.||||:||:.|.||.|::::.....:.
  Fly   310 EFRAGQSRVLITTDVWARGIDVQQVSLVINYDLPNNRELYIHRIGRSGRFGRKGVAINFVKSDDI 374

  Fly   513 KIVKDI 518
            :|::||
  Fly   375 RILRDI 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rs1NP_001286188.1 PTZ00424 148..537 CDD:185609 120/377 (32%)
DEADc 159..364 CDD:238167 69/206 (33%)
Helicase_C 393..498 CDD:278689 36/108 (33%)
CG7483NP_649788.2 PTZ00424 4..399 CDD:185609 125/395 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451712
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.