DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rs1 and mahe

DIOPT Version :9

Sequence 1:NP_001286188.1 Gene:Rs1 / 44087 FlyBaseID:FBgn0021995 Length:782 Species:Drosophila melanogaster
Sequence 2:NP_001284994.1 Gene:mahe / 31707 FlyBaseID:FBgn0029979 Length:945 Species:Drosophila melanogaster


Alignment Length:491 Identity:151/491 - (30%)
Similarity:237/491 - (48%) Gaps:66/491 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 AARLQK-RGGAEAVAAEQS---DGSEIDLSEDELKHDNLRLREKKESKKKKKKAGE--------- 134
            |.|.|| ..||......||   :.:.:.:...|.:.:..|.:.|...:...|...|         
  Fly   137 AQRYQKPNNGAGVAGGYQSNNYNAAALGMLSKEERAEIQREKAKNPGRNLVKPKWENLEPFLKDF 201

  Fly   135 ---------EDEEDEGE-KMQFADTVEANE---QITSFYQMNLSRPLMRAIGVLGYIYPTPIQAS 186
                     :.|:...| :.:...||..||   .:.||.:.:|...::..:...|:..||.||:.
  Fly   202 YNIHPNTLAKSEQQVAEIRRELEITVSGNELPHPVVSFEESSLPAHVIEEMKRQGFTKPTAIQSQ 266

  Fly   187 TIPVALLGRDICGCAATGTGKTAAYMLPTLERLLYRPLNNKAITR-----VLVLVPTRELGAQVY 246
            ..|:||.|||:.|.|.||:|||.|||||.:..:..:|    .|.|     .|||.|||||..|:.
  Fly   267 GWPIALSGRDLVGIAQTGSGKTLAYMLPAIVHIGNQP----PIIRGEGPIALVLAPTRELAQQIQ 327

  Fly   247 QVTK---QLC----QFTTIDVGLAIGGLDVKAQEAVLRQNPDIVIATPGRLIDHIKNTPSFTLDS 304
            .|.:   .||    :.|.|     .||.....|...|.:..:::|||||||||.::|. :..|..
  Fly   328 SVVRDYGHLCKPEIRHTCI-----FGGSSKVPQARDLDRGVEVIIATPGRLIDFLENR-NTNLQR 386

  Fly   305 IEVLILDEADRMLDEYFAEQMKEIINSCCKTRQTMLFSATMSEQVKDLAAVSLDKPIKVFVNN-N 368
            ...|:|||||||||..|..|:::||......||.:::|||..::|:.||...|:..|::.:.: |
  Fly   387 CTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQVVMWSATWPKEVQALAGDFLNDYIQINIGSMN 451

  Fly   369 QQVAFNLRQEFIRIREDKEGDREPILASLICRTFH-----------DHCMVFVQTKKQAHRLHIL 422
            .....|:|| .:.|..:.|..:.     |:|....           :..:|||:||.:...:..:
  Fly   452 LSANHNIRQ-IVEICTEIEKPQR-----LVCLLNEISPIKNSGNNGNKIIVFVETKIKVEDILQI 510

  Fly   423 LGLLGVRAGELHGNLTQQQRLESLKKFKEEQIDVLIATDVAARGLDIVGVKTVINFVMPITTEHY 487
            :...|..|..:||:.||.:|...||.|:..:.::|||||||:||||:..::.|||:..|.::|:|
  Fly   511 IRAEGYNATSIHGDKTQNERDSVLKDFRNGKSNILIATDVASRGLDVEDLQYVINYDYPNSSENY 575

  Fly   488 IHRVGRTARAGRAGISVSLAGEKERKIVKDIIKNAE 523
            :||:|||.|..:.|.:.:.......|..:::|...|
  Fly   576 VHRIGRTGRCQQLGTAYTFFTPDNAKQARELISVLE 611

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rs1NP_001286188.1 PTZ00424 148..537 CDD:185609 136/403 (34%)
DEADc 159..364 CDD:238167 81/216 (38%)
Helicase_C 393..498 CDD:278689 40/115 (35%)
maheNP_001284994.1 PTZ00110 136..656 CDD:240273 151/491 (31%)
DEADc 239..446 CDD:238167 81/216 (38%)
HELICc 457..594 CDD:238034 46/142 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451702
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.