DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DCTN2-p50 and JNM1

DIOPT Version :9

Sequence 1:NP_524690.1 Gene:DCTN2-p50 / 44086 FlyBaseID:FBgn0021825 Length:380 Species:Drosophila melanogaster
Sequence 2:NP_014022.1 Gene:JNM1 / 855339 SGDID:S000004908 Length:373 Species:Saccharomyces cerevisiae


Alignment Length:407 Identity:84/407 - (20%)
Similarity:152/407 - (37%) Gaps:85/407 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MADPKFQNLPGIAYDQPDVYETPDDPELDTSDYYEEEPENEAIERLHISPSVAHKRFSGATVEGS 65
            ::||..    .:.||.....:..:..|:..::..|:..:.|..|        |..|..|..||..
Yeast     6 LSDPAI----NVDYDSLIGIDNEESQEIFENEVKEDGQQEEQEE--------ASSRKDGLIVEPG 58

  Fly    66 VD-------FTDRIGRRMCRGYDTRGSSDYELVGQGEKETPVQKCQRLQIEMNELL--NEVAALQ 121
            .|       ..|::..::.|...:..:...:|....|.|:..||.:|::.|:.||.  |..:.:|
Yeast    59 RDVESLRRAIRDQLLFKIHRQNQSDCADARKLSNDEEDESRQQKLERIREELEELKIENLTSEMQ 123

  Fly   122 VDRKVADEEKQSYDAVATVISTARKVLESLKLEQVLGKEQTPGSKQVKALISQVEEFKQSGVLTA 186
            .:.|                          :|.::..|..|..|.::..|..::.|..:......
Yeast   124 TEIK--------------------------ELCEIQSKLATESSSRLTNLRKKLLETYEGQDTVI 162

  Fly   187 IPTPGTDLAATARVASLEQRISQLEKVLGAQPDKLSRLTAATNTTNVLEAVRHLSTKAALIQPD- 250
            :|....|.:...|:..|:|:||.:|:.:|. |:.|.   |..:..:|...|..|.....|:|.| 
Yeast   163 LPNIILDTSNIKRLQKLDQKISLMERFVGI-PEALE---AEEDRKSVHSKVNELYRSIQLLQGDD 223

  Fly   251 ----KLDTIEQRL--------TSLAGK--MDAIAEKSSGSAQDAKRDQKITELYDIAKRTEPVVE 301
                ||.....||        .||.||  ...:..|....::....:.|:.|:..:....:...:
Yeast   224 KAEGKLQKFRDRLVELNEEFENSLLGKKIQQDLRLKDDTVSKLVMPENKVKEINSMYSMFKQYQD 288

  Fly   302 ILPHVIERMQALEALHKYANNFAKIIAEIE------------QKQGTITTSLVNNKELLHSVQET 354
            .||.:.|||::|..:    ||  ::|...|            |:||.:....:|..:.....||.
Yeast   289 SLPLLAERMKSLNKM----NN--RVIEVYETTKGLDSQITSIQEQGKVWLKALNELDKKFDEQEV 347

  Fly   355 -FAQNLETINSKVAKVE 370
             ..:|:|.|..|:..:|
Yeast   348 KIRENMEQIRRKIDTLE 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DCTN2-p50NP_524690.1 Dynamitin 16..376 CDD:282730 80/392 (20%)
JNM1NP_014022.1 Dynamitin <175..363 CDD:398533 47/197 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103885
Panther 1 1.100 - - LDO PTHR15346
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.