DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ag5r2 and Pi15

DIOPT Version :9

Sequence 1:NP_524689.2 Gene:Ag5r2 / 44079 FlyBaseID:FBgn0020508 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_444421.2 Gene:Pi15 / 94227 MGIID:1934659 Length:269 Species:Mus musculus


Alignment Length:296 Identity:74/296 - (25%)
Similarity:102/296 - (34%) Gaps:106/296 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLALLAILIVSLALAQATDYCSSDICNGGSHIACGHSNWWDSSCPGD------------AELID 53
            |..|:..::::||            :|...:.:..   |..|||.|.:            .|..|
Mouse    14 MNSAVSLVILLSL------------LCEAHTVVLL---NPTDSSLPANNFTDTEAALSTPLESAD 63

  Fly    54 I-----------ND-----DYKWVFVHSHNDKRNYIAGGYDSNHNAACRMATMEWDDELAYLASL 102
            |           ||     ||       ||..|..:       ...|..|..|.||:.||..|..
Mouse    64 IPKARRKRYISQNDMIAILDY-------HNQVRGKV-------FPPAANMEYMVWDENLAKSAEA 114

  Fly   103 NVRQCNMVHDSCHNTDAFKYSGQNLAWQA--YSGDLPDMGYILDNSVQMWFDEVHNSNAGIIAGG 165
            ....|...|...:   ..::.||||:.:.  |...|        ..|:.|:|||.:     .|..
Mouse   115 WAATCIWDHGPSY---LLRFLGQNLSVRTGRYRSIL--------QLVKPWYDEVKD-----YAFP 163

  Fly   166 YPSGYN--------GPAIGHFTVMMSERNTRLGCAA-ARYNRDGWNQ-----VLVACNYATT-NM 215
            ||...|        ||...|:|.|:...:.|:|||. ...|.:.|..     |.:.||||.. |.
Mouse   164 YPQDCNPRCPMRCFGPMCTHYTQMVWATSNRIGCAIHTCQNMNVWGSVWRRAVYLVCNYAPKGNW 228

  Fly   216 IGRQIY------SSC--DWGAQGCGSGTNGEFGNLC 243
            ||...|      |||  .:|    |:.|:    |||
Mouse   229 IGEAPYKVGVPCSSCPPSYG----GACTD----NLC 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ag5r2NP_524689.2 SCP_euk 62..211 CDD:240180 42/164 (26%)
Pi15NP_444421.2 SCP_euk 80..223 CDD:240180 44/172 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841265
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I5254
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.900

Return to query results.
Submit another query.