powered by:
Protein Alignment Ag5r2 and CG42538
DIOPT Version :9
Sequence 1: | NP_524689.2 |
Gene: | Ag5r2 / 44079 |
FlyBaseID: | FBgn0020508 |
Length: | 254 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001163451.1 |
Gene: | CG42538 / 8673985 |
FlyBaseID: | FBgn0260646 |
Length: | 89 |
Species: | Drosophila melanogaster |
Alignment Length: | 37 |
Identity: | 10/37 - (27%) |
Similarity: | 15/37 - (40%) |
Gaps: | 2/37 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 217 GRQIYSSCDWGAQGCGSGTNGEFGNLCSTSEWYDVNS 253
||.::..|..|.. ....||.|..|.:.:..:..||
Fly 24 GRPVFQLCTGGRD--EGNRNGRFCGLTAQNGMWFYNS 58
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Ag5r2 | NP_524689.2 |
SCP_euk |
62..211 |
CDD:240180 |
|
CG42538 | NP_001163451.1 |
KU |
<53..88 |
CDD:294074 |
2/6 (33%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG2340 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.