DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ag5r2 and CRISPLD2

DIOPT Version :9

Sequence 1:NP_524689.2 Gene:Ag5r2 / 44079 FlyBaseID:FBgn0020508 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_113664.1 Gene:CRISPLD2 / 83716 HGNCID:25248 Length:497 Species:Homo sapiens


Alignment Length:207 Identity:61/207 - (29%)
Similarity:76/207 - (36%) Gaps:52/207 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 HNDKRNYIAGGYDSNHNAACRMATMEWDDELAYLASLNVRQCNMVHDSCHNTDAFKYSGQNLAWQ 130
            ||..|..:       ...|..|..|.|||||...|:....||...|..   |......||||.  
Human    63 HNKLRGQV-------QPQASNMEYMTWDDELEKSAAAWASQCIWEHGP---TSLLVSIGQNLG-- 115

  Fly   131 AYSGDLPDMGYILDNSVQMWFDEVHNSNAGIIAGGYPSGYN--------GPAIGHFTVMMSERNT 187
            |:.|.....|:    .||.|:|||.:     ....|||..|        ||...|:|.::.....
Human   116 AHWGRYRSPGF----HVQSWYDEVKD-----YTYPYPSECNPWCPERCSGPMCTHYTQIVWATTN 171

  Fly   188 RLGCAAARYNR-----DGW-NQVLVACNYATT-NMIGRQIY------SSC--DWGAQGCGSGTNG 237
            ::|||.....:     :.| |.|...|||:.. |.||...|      |.|  .:|    ||..| 
Human   172 KIGCAVNTCRKMTVWGEVWENAVYFVCNYSPKGNWIGEAPYKNGRPCSECPPSYG----GSCRN- 231

  Fly   238 EFGNLCSTSEWY 249
               |||...|.|
Human   232 ---NLCYREETY 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ag5r2NP_524689.2 SCP_euk 62..211 CDD:240180 45/158 (28%)
CRISPLD2NP_113664.1 SCP_euk 56..201 CDD:240180 45/158 (28%)
LCCL 286..370 CDD:128866
LCCL 387..479 CDD:128866
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151209
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.