DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ag5r2 and Crispld1

DIOPT Version :9

Sequence 1:NP_524689.2 Gene:Ag5r2 / 44079 FlyBaseID:FBgn0020508 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001343480.1 Gene:Crispld1 / 83691 MGIID:1934666 Length:500 Species:Mus musculus


Alignment Length:231 Identity:61/231 - (26%)
Similarity:85/231 - (36%) Gaps:63/231 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 WWDSSCPGDAELIDINDDYKWVFVHSHNDKRNYIAGGYDSNHNAACRMATMEWDDELAYLASLNV 104
            ||.:...|...:.| ||...  .:..||..|:.:       :..|..|..|.||.||...|....
Mouse    46 WWTAKQRGKRAITD-NDMQS--ILDLHNKLRSQV-------YPTASNMEYMTWDVELERSAESWA 100

  Fly   105 RQCNMVHDSCHNTDAFKYSGQNLA--WQAYSGDLPDMGYILDNSVQMWFDEVHNSNAGIIAGGYP 167
            ..|...|.......:.   ||||.  |..|.   |...:     ||.|:|||.:.:       ||
Mouse   101 EMCLWEHGPASLLPSI---GQNLGAHWGRYR---PPTFH-----VQAWYDEVRDFS-------YP 147

  Fly   168 -----SGY-----NGPAIGHFTVMMSERNTRLGCAA-ARYNRDGWNQ-----VLVACNYATT-NM 215
                 ..|     :||...|:|.::...::|:|||. ..:|.:.|.|     |.:.|||:.. |.
Mouse   148 YENECDPYCPFRCSGPVCTHYTQVVWATSSRIGCAVNLCHNMNIWGQIWPKAVYLVCNYSPKGNW 212

  Fly   216 IGRQIY------SSC--DWGAQGCGSGTNGEFGNLC 243
            .|...|      |:|  .:|. ||..       |||
Mouse   213 WGHAPYKHGRPCSACPPSFGG-GCRE-------NLC 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ag5r2NP_524689.2 SCP_euk 62..211 CDD:240180 43/166 (26%)
Crispld1NP_001343480.1 CAP_CRISPLD1 62..207 CDD:349407 43/171 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 258..281
LCCL 291..375 CDD:128866
LCCL 394..492 CDD:367672
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841223
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.