DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ag5r2 and AT4G33730

DIOPT Version :9

Sequence 1:NP_524689.2 Gene:Ag5r2 / 44079 FlyBaseID:FBgn0020508 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_195099.1 Gene:AT4G33730 / 829515 AraportID:AT4G33730 Length:172 Species:Arabidopsis thaliana


Alignment Length:179 Identity:51/179 - (28%)
Similarity:76/179 - (42%) Gaps:37/179 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 IDINDDYKWVFVHSHNDKRNYIAGGYDSNHN---AACRMATMEWDDELA-----YLASLNVRQCN 108
            ||::......:..||....:|:     ..||   ||.::..:.||..:|     |...|....|:
plant    22 IDVSSAQYSQYPQSHEYPDSYL-----RPHNAARAAVKVKPLRWDFGIATVAQDYANHLASGPCS 81

  Fly   109 MVHDSCHNTDAFKYSGQNLAWQAYSGDLPDMGYILDNSVQMWFDEVHNSNAGIIAGGYPSGYNGP 173
            :.|.|      ..| |:|||:.  |||:.     ...:|.||   ||..:   ....|.:..:||
plant    82 LEHSS------GPY-GENLAFG--SGDMS-----AAQAVAMW---VHEKS---YYDFYSNSCHGP 126

  Fly   174 AIGHFTVMMSERNTRLGCAAARYNRDGWNQVLVACNY-ATTNMIGRQIY 221
            |.||:|.::...:.||||..|:.|.   ...:|.||| ...|.||.:.|
plant   127 ACGHYTQVVWRGSARLGCGKAKCNN---GASIVVCNYDPAGNYIGARPY 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ag5r2NP_524689.2 SCP_euk 62..211 CDD:240180 45/157 (29%)
AT4G33730NP_195099.1 CAP_PR-1 39..172 CDD:349400 46/160 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.