DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ag5r2 and AT4G07820

DIOPT Version :9

Sequence 1:NP_524689.2 Gene:Ag5r2 / 44079 FlyBaseID:FBgn0020508 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_192524.1 Gene:AT4G07820 / 826263 AraportID:AT4G07820 Length:160 Species:Arabidopsis thaliana


Alignment Length:148 Identity:29/148 - (19%)
Similarity:47/148 - (31%) Gaps:48/148 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 LAYLASLNVRQCNMVHDSCHNTDAFKYSGQNLAW--------QAYSGDLPDMGY----------- 141
            |::...|..:.....:.:.||..........|.|        |||:....|.|.           
plant    17 LSFSVPLKAQDQPQDYFNAHNRARVSVGVSPLMWSQTLTAYAQAYAEKRRDCGLFLSGGPYGETI 81

  Fly   142 ---ILDNSVQMW----------FDEVHNS-NAGIIAGGYPSGYNGPAIGHFTVMMSERNTRLGCA 192
               |:|.|.:.:          :|...|: .||....||..            ::..::..||||
plant    82 KADIIDFSAEEFVSTFLNQKSDYDYTTNTCRAGKSCDGYKQ------------VLFRKSVFLGCA 134

  Fly   193 AARYNRDGWNQVLVACNY 210
            ..:.|..|:   |..|:|
plant   135 KVKCNNGGF---LAICSY 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ag5r2NP_524689.2 SCP_euk 62..211 CDD:240180 29/148 (20%)
AT4G07820NP_192524.1 CAP_PR-1 29..160 CDD:349400 27/136 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.