DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ag5r2 and PR-1-LIKE

DIOPT Version :9

Sequence 1:NP_524689.2 Gene:Ag5r2 / 44079 FlyBaseID:FBgn0020508 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_179589.1 Gene:PR-1-LIKE / 816518 AraportID:AT2G19990 Length:176 Species:Arabidopsis thaliana


Alignment Length:154 Identity:45/154 - (29%)
Similarity:64/154 - (41%) Gaps:39/154 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 HNAACRM---ATMEWDDELAYLASL----NVRQCNMVHDSCHNTDAFKYSGQNLA--WQAYSGDL 136
            ||.|..|   ..|.|::.||..|..    ..|.|.|.    |:...|   |:|||  |...||.:
plant    49 HNKARAMVGVGPMVWNETLATYAQSYAHERARDCAMK----HSLGPF---GENLAAGWGTMSGPV 106

  Fly   137 PDMGYILDNSVQMWFDEVHNSNAGIIAGGYPS---GYNGPAIGHFTVMMSERNTRLGCAAARYNR 198
                     :.:.|..|..|.:       |.|   |.:| ..||:|.::...:.|||||:.|...
plant   107 ---------ATEYWMTEKENYD-------YDSNTCGGDG-VCGHYTQIVWRDSVRLGCASVRCKN 154

  Fly   199 DGWNQVLVACNY-ATTNMIGRQIY 221
            |.:  :.|.|:| ...|.||::.|
plant   155 DEY--IWVICSYDPPGNYIGQRPY 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ag5r2NP_524689.2 SCP_euk 62..211 CDD:240180 41/142 (29%)
PR-1-LIKENP_179589.1 CAP_PR-1 42..176 CDD:349400 44/152 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.