DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ag5r2 and PR1

DIOPT Version :9

Sequence 1:NP_524689.2 Gene:Ag5r2 / 44079 FlyBaseID:FBgn0020508 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_179068.1 Gene:PR1 / 815949 AraportID:AT2G14610 Length:161 Species:Arabidopsis thaliana


Alignment Length:169 Identity:48/169 - (28%)
Similarity:69/169 - (40%) Gaps:46/169 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 PGDAELIDINDDYKWVFVHSHNDKRNYIAGGYDSNHNAACRMATMEWDDELAYLASLNVRQ---- 106
            |..|:  |...||    :..||..|..:..|            .|:||:.:|..|.....|    
plant    23 PSKAQ--DSPQDY----LRVHNQARGAVGVG------------PMQWDERVAAYARSYAEQLRGN 69

  Fly   107 CNMVHDSCHNTDAFKYSGQNLAWQAYSGDLPDMGYILDNSVQMWFDEVHNSNAGIIAGGYPSGYN 171
            |.::|      ....| |:||||.  ||||..:     ::|.||..|..|.|       |.:...
plant    70 CRLIH------SGGPY-GENLAWG--SGDLSGV-----SAVNMWVSEKANYN-------YAANTC 113

  Fly   172 GPAIGHFTVMMSERNTRLGCAAARYNRDGWNQVLVACNY 210
            ....||:|.::..::.|||||..|.|..|   .:::|||
plant   114 NGVCGHYTQVVWRKSVRLGCAKVRCNNGG---TIISCNY 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ag5r2NP_524689.2 SCP_euk 62..211 CDD:240180 43/153 (28%)
PR1NP_179068.1 SCP_PR-1_like 30..161 CDD:240181 45/160 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.