DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ag5r2 and PRB1

DIOPT Version :9

Sequence 1:NP_524689.2 Gene:Ag5r2 / 44079 FlyBaseID:FBgn0020508 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_179064.1 Gene:PRB1 / 815945 AraportID:AT2G14580 Length:161 Species:Arabidopsis thaliana


Alignment Length:162 Identity:47/162 - (29%)
Similarity:66/162 - (40%) Gaps:44/162 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 DINDDYKWVFVHSHNDKRNYIAGGYDSNHNAACRMATMEWDDELAYLASLNVRQ----CNMVHDS 113
            |...||    |::||..|:.|..|            .|:||:.||..|.....|    |.:||  
plant    28 DSQQDY----VNAHNQARSQIGVG------------PMQWDEGLAAYARNYANQLKGDCRLVH-- 74

  Fly   114 CHNTDAFKYSGQNLAWQAYSGDLPDMGYILDNSVQMWFDEVHNSNAGIIAGGYPSGYNGPAIGHF 178
                ....| |:|||  ...|||..:.     :|.:|.:|..|.|       |.:.......||:
plant    75 ----SRGPY-GENLA--KSGGDLSGVA-----AVNLWVNEKANYN-------YDTNTCNGVCGHY 120

  Fly   179 TVMMSERNTRLGCAAARYNRDGWNQVLVACNY 210
            |.::...:.|||||..|.|..|   .:::|||
plant   121 TQVVWRNSVRLGCAKVRCNNGG---TIISCNY 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ag5r2NP_524689.2 SCP_euk 62..211 CDD:240180 44/153 (29%)
PRB1NP_179064.1 CAP_PR-1 30..161 CDD:349400 46/160 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.