DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ag5r2 and Crispld2

DIOPT Version :9

Sequence 1:NP_524689.2 Gene:Ag5r2 / 44079 FlyBaseID:FBgn0020508 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001297564.1 Gene:Crispld2 / 78892 MGIID:1926142 Length:495 Species:Mus musculus


Alignment Length:291 Identity:69/291 - (23%)
Similarity:97/291 - (33%) Gaps:97/291 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLALLAILIVSLALAQATDYCSSDICNGGSHIACGHSNWWDSSCPGDAELIDINDDYKWVFVHS 65
            |...|..::::.|||                 :.||...::   .|....|..:...|:....||
Mouse     1 MSCLLNNMVLMGLAL-----------------LVCGVQAFF---LPNTTSLEKLLSKYQHAEPHS 45

  Fly    66 -----------------HNDKRNYIAGGYDSNHNAACRMATMEWDDELAYLASLNVRQCNMVHDS 113
                             ||..|..:       :..|..|..|.||:||...|:....:|...|..
Mouse    46 RVRRAIPMSDRQEILMLHNKLRGQV-------YPPASNMEHMTWDEELERSAAAWAHRCLWEHGP 103

  Fly   114 CHNTDAFKYSGQNLA--WQAYSGDLPDMGYILDNSVQMWFDEVHNSNAGIIAGGYPSGY------ 170
               ....:..|||||  |..|...    |:    .||.|:|||.:..       ||..:      
Mouse   104 ---AGLLRSIGQNLAVHWGRYRSP----GF----HVQSWYDEVKDYT-------YPYPHECTPRC 150

  Fly   171 ----NGPAIGHFTVMMSERNTRLGCAAARYNR-----DGW-NQVLVACNYATT-NMIGRQIY--- 221
                :||...|:|.|:.....::|||......     |.| |.|.:.|||:.. |.||...|   
Mouse   151 RERCSGPMCTHYTQMVWATTNKIGCAVHTCRNMNVWGDTWENAVYLVCNYSPKGNWIGEAPYKHG 215

  Fly   222 ---SSC--DWGAQGCGSGTNGEFGNLCSTSE 247
               |.|  .:|. ||       ..|||..:|
Mouse   216 RPCSECPSSYGG-GC-------LNNLCHRAE 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ag5r2NP_524689.2 SCP_euk 62..211 CDD:240180 45/183 (25%)
Crispld2NP_001297564.1 CAP 56..201 CDD:381818 43/169 (25%)
LCCL 284..368 CDD:128866
LCCL 387..486 CDD:367672
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841286
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.