DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ag5r2 and Pi16

DIOPT Version :10

Sequence 1:NP_524689.2 Gene:Ag5r2 / 44079 FlyBaseID:FBgn0020508 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_076223.3 Gene:Pi16 / 74116 MGIID:1921366 Length:498 Species:Mus musculus


Alignment Length:187 Identity:46/187 - (24%)
Similarity:70/187 - (37%) Gaps:38/187 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 INDDYKWVFVHSHNDKRNYIAGGYDSNHNAACRMATMEWDDELAYLASLNVRQCNMVHDSCHNTD 118
            :.:|.|...|..||..|..::       ..|..|..|.||||||..|....::|...|:..... 
Mouse    30 LTEDEKQTMVDLHNQYRAQVS-------PPASDMLQMRWDDELAAFAKAYAQKCVWGHNKERGR- 86

  Fly   119 AFKYSGQNLAWQAYSGDLPDMGYILDNSVQMWFDEVHNSNAGIIAGGYPSGYNGP--AIGHFTVM 181
                .|:||.      .:.|.|..:..:|..|.:|....|       :.:....|  ..||:|.:
Mouse    87 ----RGENLF------AITDEGMDVPLAVGNWHEEHEYYN-------FSTATCDPNQMCGHYTQV 134

  Fly   182 MSERNTRLGCAA----ARYNRDGWNQVLVACNYATT-NMIGRQIY------SSCDWG 227
            :..:..|:||.:    .....:..|..|:.|||... |:.||:.|      |.|..|
Mouse   135 VWSKTERIGCGSHFCETLQGVEEANIHLLVCNYEPPGNVKGRKPYQEGTPCSQCPLG 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ag5r2NP_524689.2 CAP_euk 62..211 CDD:349399 36/154 (23%)
Pi16NP_076223.3 CAP_PI16_HrTT-1 35..168 CDD:349405 37/157 (24%)
DUF5585 <183..458 CDD:465521 3/9 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 204..277
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 317..407
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 419..467
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.