DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ag5r2 and CRISP2

DIOPT Version :9

Sequence 1:NP_524689.2 Gene:Ag5r2 / 44079 FlyBaseID:FBgn0020508 Length:254 Species:Drosophila melanogaster
Sequence 2:XP_005249406.1 Gene:CRISP2 / 7180 HGNCID:12024 Length:278 Species:Homo sapiens


Alignment Length:150 Identity:37/150 - (24%)
Similarity:59/150 - (39%) Gaps:23/150 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 VHSHNDKRNYIAGGYDSNHNAACRMATMEWDDELAYLASLNVRQCNMVHDSCHNTDAFKYSGQNL 127
            |:.||:.|..::       ..|..|..|||..|:...|.....:|.:.|....:.......|:||
Human    41 VNKHNELRKAVS-------PPASNMLKMEWSREVTTNAQRWANKCTLQHSDPEDRKTSTRCGENL 98

  Fly   128 AWQAYSGDLPDMGYILDNSVQMWFDEVHNSNAGIIAGGYPSGYNGPAIGHFTVMMSERNTRLGCA 192
                |....|..   ..:::|.|:||:    ...:.|..|...|. .:||:|.::.....::||.
Human    99 ----YMSSDPTS---WSSAIQSWYDEI----LDFVYGVGPKSPNA-VVGHYTQLVWYSTYQVGCG 151

  Fly   193 AARY--NRDGWNQVLVACNY 210
            .| |  |:|......| |.|
Human   152 IA-YCPNQDSLKYYYV-CQY 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ag5r2NP_524689.2 SCP_euk 62..211 CDD:240180 36/149 (24%)
CRISP2XP_005249406.1 SCP_CRISP 35..172 CDD:240183 36/149 (24%)
Crisp 224..278 CDD:285731
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151272
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.