DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ag5r2 and Glipr1l2

DIOPT Version :9

Sequence 1:NP_524689.2 Gene:Ag5r2 / 44079 FlyBaseID:FBgn0020508 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_080499.1 Gene:Glipr1l2 / 67537 MGIID:1914787 Length:332 Species:Mus musculus


Alignment Length:276 Identity:52/276 - (18%)
Similarity:95/276 - (34%) Gaps:89/276 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLALLAILIVSLALAQATDYCSSDICNGGSHIACGHSNWWDSSCPGDAELIDINDDYKWVFVHS 65
            :||..|.:|:|...|                          ::..|.:.::..||:     :|..
Mouse    24 LKLCELWLLLVGSGL--------------------------NAKLPLEEDVDFINE-----YVGL 57

  Fly    66 HNDKRNYIAGGYDSNHNAACRMATMEWDDELAYLASLNVRQC----NMVHDSCHNT-DAFKYSGQ 125
            ||:.|..:       ......:..|.||..|:..|....::|    |...|..|.: ..|...|:
Mouse    58 HNELRGTV-------FPPGVNLRFMTWDVALSRTARAWGKKCMYSRNTHLDKLHESHPVFTEIGE 115

  Fly   126 NLAWQAYSGDLPDMGYILDNSVQMWFDE-----------VHNSNAGIIAGGYPSGYNGPAIGHFT 179
            |:    :.|.:.|  :.:..:::.|.:|           |.:.|.                .|:.
Mouse   116 NM----WVGPVED--FTVTTAIRSWHEERKSYSYLNDTCVEDQNC----------------SHYI 158

  Fly   180 VMMSERNTRLGCAAARYNRDG--WNQVLVACNYATTNMIGRQIYSSCDWGAQGCGSGTNGEFGNL 242
            .::.:.:.::|||.....|.|  .:..|..||||....:.|:.|.:..:.:: ||.|.... ..|
Mouse   159 QLVWDSSYKVGCAVTSCARAGGFTHAALFICNYAPGGTLTRRPYQAGQFCSR-CGPGDQCT-DYL 221

  Fly   243 CSTSE---------WY 249
            ||.:.         ||
Mouse   222 CSNTVRDEATYYQFWY 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ag5r2NP_524689.2 SCP_euk 62..211 CDD:240180 31/166 (19%)
Glipr1l2NP_080499.1 SCP 49..194 CDD:294090 35/178 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 293..332
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841412
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I5254
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.800

Return to query results.
Submit another query.