DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ag5r2 and crispl

DIOPT Version :9

Sequence 1:NP_524689.2 Gene:Ag5r2 / 44079 FlyBaseID:FBgn0020508 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001025526.1 Gene:crispl / 594930 XenbaseID:XB-GENE-5768874 Length:314 Species:Xenopus tropicalis


Alignment Length:212 Identity:50/212 - (23%)
Similarity:74/212 - (34%) Gaps:66/212 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 HND-KRNYIAGGYDSNHNAACRMATMEWDDELAYLASLNVRQCNMVHD----------SCHNTDA 119
            ||: :||  |....||      |..|.|.|..|..|:.....|...|.          ||     
 Frog   115 HNELRRN--ANPPPSN------MLKMVWSDLAAKSAAKWANSCKQYHSLKPERTIPGFSC----- 166

  Fly   120 FKYSGQNLAWQAYSGDLPDMGYILDNSVQMWFDEVHNSNAGIIAGGYPSGYNGPAIG----HFTV 180
                |:||...:|.....|:       ::.::.|:.:         :..|.....:|    |||.
 Frog   167 ----GENLFMASYKASWEDV-------IRAFYSEIED---------FLYGKGAKEVGLQILHFTQ 211

  Fly   181 MMSERNTRLGCAAARYN-RDGWNQVLVACNYATTNMIG------------RQIYSSCDWGAQGCG 232
            :|...:..:|||||:.. .|...:....|:||.....|            ....|||:.|.  |.
 Frog   212 VMWFSSWLVGCAAAQCPITDHSLEFYFVCHYAPAGNYGNVGIPYKTGKPCEDCKSSCENGL--CT 274

  Fly   233 SGTN--GEFGNLCSTSE 247
            :|.|  .:|.| |.|.:
 Frog   275 NGCNFQNKFSN-CDTPD 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ag5r2NP_524689.2 SCP_euk 62..211 CDD:240180 36/160 (23%)
crisplNP_001025526.1 CAP_CRISP 106..245 CDD:349402 38/162 (23%)
Crisp 261..314 CDD:369954 11/33 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.