DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ag5r2 and pi15a

DIOPT Version :9

Sequence 1:NP_524689.2 Gene:Ag5r2 / 44079 FlyBaseID:FBgn0020508 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001153449.1 Gene:pi15a / 561978 ZFINID:ZDB-GENE-040724-135 Length:260 Species:Danio rerio


Alignment Length:303 Identity:78/303 - (25%)
Similarity:104/303 - (34%) Gaps:110/303 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LAILIVSLALAQATDYCSSDICNGGSHIACGHSNWWDSSCPGDAELIDI---------------- 54
            |||.|:.|.::          | |.|.:| |.|....||.|. ..|.||                
Zfish     6 LAIDILLLCIS----------C-GASALA-GFSPTASSSLPA-TNLTDIGFAPPKYLTEAANIPK 57

  Fly    55 ---------ND-----DYKWVFVHSHNDKRNYIAGGYDSNHNAACRMATMEWDDELAYLASLNVR 105
                     ||     ||       ||..|..:       ...|..|..|.|||.||..|.....
Zfish    58 TRRKRYISQNDMLAILDY-------HNKVRGKV-------FPPASNMEYMVWDDTLAKTAEQWAS 108

  Fly   106 QCNMVHDSCHNTDAFKYSGQNLAWQA--YSGDLPDMGYILDNSVQMWFDEVHNSNAGIIAGGYPS 168
            .|...|..   .:..::.||||:.:.  |...|        ..|:.|.|||.:     .:..||.
Zfish   109 TCIWEHGP---RNLLRFLGQNLSVRTGRYRSIL--------QLVKPWHDEVKD-----YSFPYPR 157

  Fly   169 GYN--------GPAIGHFTVMMSERNTRLGCAA-ARYNRDGWNQV-----LVACNYATT-NMIGR 218
            ..|        ||...|:|.|:...:.::|||. ..:|.:.|..|     .:.|||:.. |.||.
Zfish   158 DCNPRCPLKCYGPMCTHYTQMVWATSNKVGCAINTCHNMNVWGSVWKRATYLVCNYSPKGNWIGE 222

  Fly   219 QIY------SSC--DWGAQGCGSGTNGEFGNLCSTSEWYDVNS 253
            ..|      |.|  .:|    ||.:|    |:|..:    |||
Zfish   223 APYKVGVPCSMCPPSYG----GSCSN----NMCFPA----VNS 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ag5r2NP_524689.2 SCP_euk 62..211 CDD:240180 41/164 (25%)
pi15aNP_001153449.1 SCP_euk 71..214 CDD:240180 43/172 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170585783
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5251
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.900

Return to query results.
Submit another query.