DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ag5r2 and PI15

DIOPT Version :9

Sequence 1:NP_524689.2 Gene:Ag5r2 / 44079 FlyBaseID:FBgn0020508 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001311332.1 Gene:PI15 / 51050 HGNCID:8946 Length:258 Species:Homo sapiens


Alignment Length:292 Identity:78/292 - (26%)
Similarity:103/292 - (35%) Gaps:100/292 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LLAILIVSLALAQATDYCSSDICNGGSHIACGHSNWWDSSCPGD----------AEL-------- 51
            ::||..||.||      ..|.:|...:.:..   |..|||.|.:          |:|        
Human     1 MIAISAVSSAL------LFSLLCEASTVVLL---NSTDSSPPTNNFTDIEAALKAQLDSADIPKA 56

  Fly    52 -----IDIND-----DYKWVFVHSHNDKRNYIAGGYDSNHNAACRMATMEWDDELAYLASLNVRQ 106
                 |..||     ||       ||..|..:       ...|..|..|.||:.||..|......
Human    57 RRKRYISQNDMIAILDY-------HNQVRGKV-------FPPAANMEYMVWDENLAKSAEAWAAT 107

  Fly   107 CNMVHDSCHNTDAFKYSGQNLAWQA--YSGDLPDMGYILDNSVQMWFDEVHNSNAGIIAGGYPSG 169
            |...|...:   ..::.||||:.:.  |...|        ..|:.|:|||.:     .|..||..
Human   108 CIWDHGPSY---LLRFLGQNLSVRTGRYRSIL--------QLVKPWYDEVKD-----YAFPYPQD 156

  Fly   170 YN--------GPAIGHFTVMMSERNTRLGCAA-ARYNRDGWNQ-----VLVACNYATT-NMIGRQ 219
            .|        ||...|:|.|:...:.|:|||. ...|.:.|..     |.:.||||.. |.||..
Human   157 CNPRCPMRCFGPMCTHYTQMVWATSNRIGCAIHTCQNMNVWGSVWRRAVYLVCNYAPKGNWIGEA 221

  Fly   220 IY------SSC--DWGAQGCGSGTNGEFGNLC 243
            .|      |||  .:|    ||.|:    |||
Human   222 PYKVGVPCSSCPPSYG----GSCTD----NLC 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ag5r2NP_524689.2 SCP_euk 62..211 CDD:240180 42/164 (26%)
PI15NP_001311332.1 CAP_PI15 67..212 CDD:349408 44/174 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151188
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5261
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.900

Return to query results.
Submit another query.