DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ag5r2 and crisp1.3

DIOPT Version :9

Sequence 1:NP_524689.2 Gene:Ag5r2 / 44079 FlyBaseID:FBgn0020508 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001008204.1 Gene:crisp1.3 / 493566 XenbaseID:XB-GENE-951048 Length:240 Species:Xenopus tropicalis


Alignment Length:215 Identity:43/215 - (20%)
Similarity:81/215 - (37%) Gaps:30/215 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 DSSCPGDAELIDINDDYKWVFVHSHNDKRNYIAGGYDSNHNAACR-MATMEWDDELAYLASLNVR 105
            :|:.|..:.:...|.....:.:::||:        |..|.:.:.| |..|.|:.:.|..|:....
 Frog    18 ESADPPFSSISTDNVTVTQIIINAHNN--------YRRNASPSARNMLKMVWNKDAAINAASWAA 74

  Fly   106 QCNMVHD-SCHNTDAFKYSGQNLAWQAYSGDLPDMGYILDNSVQMWFDEVHNSNAGIIAGGYPSG 169
            .|:..|. |...|......|:||...:|...       .:.:|:.|:.|.::...|:       |
 Frog    75 TCSESHSPSDKRTIPGFGCGENLYMASYPAS-------WEEAVKGWYSEYNDFQYGV-------G 125

  Fly   170 YNGPAI--GHFTVMMSERNTRLGCAAARYNRDGWNQVLVACNYATTNMIGRQIYSSCDWGAQGCG 232
            ...|.:  ||:|.:|...:..:||:.:...:..:....| |.|.....:...:.:....|.:...
 Frog   126 PKSPGLVTGHYTQVMWYNSYMVGCSVSYCPKSPYKYFYV-CQYCPAGNLDSTMSTPYKTGPKCAD 189

  Fly   233 SGT---NGEFGNLCSTSEWY 249
            ..|   ||...|.|...:.|
 Frog   190 CPTACDNGLCTNYCPYQDLY 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ag5r2NP_524689.2 SCP_euk 62..211 CDD:240180 32/152 (21%)
crisp1.3NP_001008204.1 CAP_CRISP 33..170 CDD:349402 33/159 (21%)
Crisp 187..240 CDD:369954 6/23 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.