DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ag5r2 and Ag5r

DIOPT Version :9

Sequence 1:NP_524689.2 Gene:Ag5r2 / 44079 FlyBaseID:FBgn0020508 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001245671.1 Gene:Ag5r / 44631 FlyBaseID:FBgn0015010 Length:256 Species:Drosophila melanogaster


Alignment Length:253 Identity:128/253 - (50%)
Similarity:171/253 - (67%) Gaps:11/253 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ILIVSLAL----AQATDYCSSDICNGGSHIACGHSNWWDSSCPGDAELIDINDDYKWVFVHSHND 68
            ::|.||:|    |.|||||... |....::.|.::..|.||||.||.|:.::...|...|...|:
  Fly     5 VIIFSLSLAFGIASATDYCKKS-CGSTKNLGCDNNGAWASSCPSDATLLTLSSAEKDALVARTNE 68

  Fly    69 KRNYIAGGYDSNHNAACRMATMEWDDELAYLASLNVRQCNMVHDSCHNTDAFKYSGQNLAWQAYS 133
            .||:||||.::|.:|||||||::|:|||||||||||:.|.|.||.|||||||.:|||||||..|.
  Fly    69 YRNHIAGGLNANLSAACRMATIKWNDELAYLASLNVKSCQMKHDGCHNTDAFDWSGQNLAWMGYY 133

  Fly   134 GDLPDMGYILDNSVQMWFDE-VHNSNAGIIAGGYPSGYNGPAIGHFTVMMSERNTRLGCAAARYN 197
            ..| ::.:.|:..|.||:|| |:...|.|.|  |||.|||||||||||::::|||.:|||||.|:
  Fly   134 NPL-NVTHYLEWGVDMWYDEAVYTKQAYIDA--YPSNYNGPAIGHFTVLVADRNTEVGCAAATYS 195

  Fly   198 RDG--WNQVLVACNYATTNMIGRQIYSSCDWGAQGCGSGTNGEFGNLCSTSEWYDVNS 253
            ..|  :...|:|||||.||::|.::||||...|..|.:|||.::..|||..|.|:||:
  Fly   196 VSGQSYKAFLLACNYAATNVLGIKMYSSCSKAASKCTTGTNPKYKYLCSAKEEYNVNN 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ag5r2NP_524689.2 SCP_euk 62..211 CDD:240180 86/151 (57%)
Ag5rNP_001245671.1 SCP_euk 59..211 CDD:240180 87/154 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440522
Domainoid 1 1.000 121 1.000 Domainoid score I11228
eggNOG 1 0.900 - - E1_COG2340
Homologene 1 1.000 - - H77274
Inparanoid 1 1.050 76 1.000 Inparanoid score I5251
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26030
OrthoDB 1 1.010 - - D109749at50557
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
109.910

Return to query results.
Submit another query.