DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ag5r2 and scpr-C

DIOPT Version :10

Sequence 1:NP_524689.2 Gene:Ag5r2 / 44079 FlyBaseID:FBgn0020508 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_650053.1 Gene:scpr-C / 41348 FlyBaseID:FBgn0037879 Length:262 Species:Drosophila melanogaster


Alignment Length:43 Identity:9/43 - (20%)
Similarity:22/43 - (51%) Gaps:2/43 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 FVISIVTLALISNLINLVIFAKLMKDKMSGVSEAQKSKRRKKW 214
            |:..:|.|.|:|.:.::.:  :|.::..:||:..:.......|
  Fly     2 FLRILVALCLVSAISSITL--QLCQEFCAGVNGGESYAYCSPW 42

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ag5r2NP_524689.2 CAP_euk 62..211 CDD:349399 8/38 (21%)
scpr-CNP_650053.1 CAP_euk 57..210 CDD:349399
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.