DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ag5r2 and crisp1.7

DIOPT Version :9

Sequence 1:NP_524689.2 Gene:Ag5r2 / 44079 FlyBaseID:FBgn0020508 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_989314.1 Gene:crisp1.7 / 394939 XenbaseID:XB-GENE-5779195 Length:244 Species:Xenopus tropicalis


Alignment Length:217 Identity:47/217 - (21%)
Similarity:68/217 - (31%) Gaps:59/217 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 ELIDINDDYKWVFVHSHNDKRNYIAGGYDSNHNAACRMATMEWDDELAYLASLNVRQCNMVHD-- 112
            :::||::.|:                  .|.:..|..|..|.|..|....|......||..|.  
 Frog    36 KIVDIHNAYR------------------RSANPTASNMLKMSWSIEAENNAKNWATTCNQYHSQP 82

  Fly   113 --------SCHNTDAFKYSGQNLAWQAYSGDLPDMGYILDNSVQMWFDEVHNSNAGIIAGGYPSG 169
                    :|         |:||...:|.....::       :|....|..|...|:.|...   
 Frog    83 AARQIANITC---------GENLFMSSYPASWEEV-------IQSLHSEYDNFEYGVGAKAV--- 128

  Fly   170 YNGPAIGHFTVMMSERNTRLGCAAARYNRDGWN-------QVLVACNYATTNMIGRQIYSSCDWG 227
              |..|||:|.:|..::.|:||.......||..       |...|.|||.......:...||...
 Frog   129 --GLVIGHYTQVMWYKSYRIGCYCTECPNDGVRLKYYYVCQYYPAGNYADRINYPYKSGPSCADC 191

  Fly   228 AQGCGSGTNGEFGNLCSTSEWY 249
            ...|   .||...|.|...:.|
 Frog   192 PDAC---DNGLCTNPCPYEDQY 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ag5r2NP_524689.2 SCP_euk 62..211 CDD:240180 34/165 (21%)
crisp1.7NP_989314.1 CAP_CRISP 32..171 CDD:349402 35/173 (20%)
Crisp 188..243 CDD:369954 7/26 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.