DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ag5r2 and glipr1b

DIOPT Version :9

Sequence 1:NP_524689.2 Gene:Ag5r2 / 44079 FlyBaseID:FBgn0020508 Length:254 Species:Drosophila melanogaster
Sequence 2:XP_005159058.1 Gene:glipr1b / 393547 ZFINID:ZDB-GENE-040426-1459 Length:255 Species:Danio rerio


Alignment Length:205 Identity:50/205 - (24%)
Similarity:75/205 - (36%) Gaps:43/205 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 VHSHNDKRNYI---AGGYDSNHNAACRMATMEWDDELAYLASLNVRQCNMVHDSC---HNTDAFK 121
            |.:||..|..:   |.|..|.......|  ..||.|||..|....|.|...|...   .....|.
Zfish    38 VKAHNTHRARVSPPAAGARSMVRQVFGM--QSWDKELAKGARDRARHCKGSHYPSLGHFGHPLFG 100

  Fly   122 YSGQNLAWQAYSGDLPDMGYILDNSVQMWFDE----VHNSNAGIIAGGYPSGYNGPAIGHFTVMM 182
            :.|:|: |..    .|...:.::|:|..|..|    |.|:|...:.            ||:..:|
Zfish   101 WMGENI-WLG----SPFSAFSVENAVHRWSKEGAYSVKNNNCSRLC------------GHYAQLM 148

  Fly   183 SERNTRLGCAAARYNRDGWN------QVLVACNYATTNMIGRQIYSSCDWGAQGCGSGTNGEF-- 239
            ...:.::|||....::...|      ..:..|||..|.    |::....:.|.|| ||...|.  
Zfish   149 WSTSFKMGCAVNVCSKGIENFSTHPESTIFVCNYGDTG----QVHGVTPYMAMGC-SGCGSEICR 208

  Fly   240 GNLCSTSEWY 249
            .|:| ..:|:
Zfish   209 DNVC-RYDWF 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ag5r2NP_524689.2 SCP_euk 62..211 CDD:240180 38/163 (23%)
glipr1bXP_005159058.1 SCP 32..185 CDD:294090 39/165 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.