DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ag5r2 and CG6628

DIOPT Version :9

Sequence 1:NP_524689.2 Gene:Ag5r2 / 44079 FlyBaseID:FBgn0020508 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_648386.1 Gene:CG6628 / 39183 FlyBaseID:FBgn0036072 Length:277 Species:Drosophila melanogaster


Alignment Length:258 Identity:94/258 - (36%)
Similarity:133/258 - (51%) Gaps:17/258 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LALLAILIVSL----ALAQATDYCSSDICNG-GSHIACGHSNWWDSSCPGDAELIDINDDYKWVF 62
            |.|...|.|:.    |.|..||||.|.:|.. ..||||.:.......|..||.|:::. ..:.:.
  Fly     9 LMLFGFLQVAFSQDNATAPPTDYCQSGLCPSLKKHIACKNKGELGKQCSPDAHLVNLT-GLQDLI 72

  Fly    63 VHSHNDKRNYIAGGYDSNHNAACRMATMEWDDELAYLASLNVRQCNMVHDSCHNTDAFKYSGQNL 127
            :..||..||.:|.|...|.....||||::|..|||.||:|||:||.:.|||||||..|..|||||
  Fly    73 LGEHNALRNVLASGKIINLPKPDRMATLQWHSELADLATLNVKQCVLQHDSCHNTPDFHNSGQNL 137

  Fly   128 AWQAYSGDLPDMG-----YILDNSVQMWFDEVHNSNAGIIAGGYPSGYNGPAIGHFTVMMSERNT 187
            |....: .||:.|     .::..|:..|:::..|.....:. .:|.|..|.:|.:|.||..:.||
  Fly   138 ALVNIT-LLPEDGNHTDECLVKESIGGWWNQSINITKEQLQ-RFPKGKLGDSIRNFAVMARDNNT 200

  Fly   188 RLGCAAARYNRD-GWNQVLVACNYATTNMIGRQIYSSCDWGAQGCGSGTNGEFGNLCSTSEWY 249
            .:||||.|:.:. |....|:|||||:..:....||..   .|.||.||::.::.:||...|.|
  Fly   201 HVGCAALRFEKPAGHPLFLLACNYASNYVPDWPIYKE---KAIGCQSGSDLKYPSLCKAGEEY 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ag5r2NP_524689.2 SCP_euk 62..211 CDD:240180 61/154 (40%)
CG6628NP_648386.1 SCP_euk 69..225 CDD:240180 61/157 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440558
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Homologene 1 1.000 - - H77274
Inparanoid 1 1.050 76 1.000 Inparanoid score I5251
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26030
OrthoDB 1 1.010 - - D109749at50557
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
109.910

Return to query results.
Submit another query.