DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ag5r2 and CG34002

DIOPT Version :9

Sequence 1:NP_524689.2 Gene:Ag5r2 / 44079 FlyBaseID:FBgn0020508 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001034029.2 Gene:CG34002 / 3885644 FlyBaseID:FBgn0054002 Length:350 Species:Drosophila melanogaster


Alignment Length:249 Identity:74/249 - (29%)
Similarity:119/249 - (47%) Gaps:10/249 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LLAILIVSLA-LAQATDYCSSDICNGGS---HIACGHSNWWDSSCPGDAELIDINDDYKWVFVHS 65
            ||.:..::|. |...|:||....|....   ||.|.:|..|...|..|.::||:....|.:.::.
  Fly    11 LLLLFGLNLVFLLPETNYCHLKNCPADKKLPHIGCNNSGSWSPKCGKDPKIIDVPKHIKKLILNH 75

  Fly    66 HNDKRNYIAGGYDSNHNAACRMATMEWDDELAYLASLNVRQCNM-VHDSCHNTDAFKYSGQNLAW 129
            ||..|:.:|||.......|.||..::||.|||.||::.|::|:: ..|.|.:|:.|.....:..:
  Fly    76 HNTYRDIVAGGQMHRLPIAARMLKLKWDHELALLATILVKRCDLQPTDHCISTEEFSSPSYHAVY 140

  Fly   130 QAYSGDLPDMGYILDNSVQMWFDEV-HNSNAGIIAGGYPSGYNGPAIGHFTVMMSERNTRLGCAA 193
            ..:... .|...|:.:.:..|:|:. |.|::.:|.|   .......||||..|:...:.|||||.
  Fly   141 NKFKAK-EDTFRIVRSQLNAWYDQYKHVSSSSLIDG---LSTAKKEIGHFLRMIVGPSNRLGCAI 201

  Fly   194 ARYNRDGWNQVLVACNYATTNMIGRQIYSSCDWGAQGCGSGTNGEFGNLCSTSE 247
            |...:.||....:||.|:.:......:|.........|.:|.||:|.|||:.:|
  Fly   202 ASIEKGGWTHQWLACLYSCSPQKNSLLYEYSGKPGVYCTTGINGKFQNLCNDTE 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ag5r2NP_524689.2 SCP_euk 62..211 CDD:240180 45/150 (30%)
CG34002NP_001034029.2 SCP_euk 69..219 CDD:240180 46/153 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455057
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5251
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.800

Return to query results.
Submit another query.