DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ag5r2 and CG3640

DIOPT Version :9

Sequence 1:NP_524689.2 Gene:Ag5r2 / 44079 FlyBaseID:FBgn0020508 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_611950.1 Gene:CG3640 / 37942 FlyBaseID:FBgn0035042 Length:296 Species:Drosophila melanogaster


Alignment Length:258 Identity:82/258 - (31%)
Similarity:127/258 - (49%) Gaps:12/258 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLALLAILIVSLAL--AQATDYCSSDIC-NGGSHIACGHSNWWDSSCPGDAELIDINDDYKWVF 62
            :::..:.::||:|..  |.:.|||....| ....|:||.::..:...|..:|.||.:::..:...
  Fly     4 IRVWFICLVIVTLNSFPAYSWDYCQEHWCPRSTDHVACNNNGTFGLDCGREARLIPLSNQLQAFI 68

  Fly    63 VHSHNDKRNYIAGGYDSNHNAACRMATMEWDDELAYLASLNVRQCNMVHDSCHNTDAFKYSGQNL 127
            ||..|..||.:|.|..|....|.|||::.||.|||.||.|..::|::..|.|.||..||:.||..
  Fly    69 VHQVNFYRNQVASGGLSAFGPARRMASVRWDPELAQLAELAAKRCSLSGDGCRNTRRFKHVGQLT 133

  Fly   128 AWQAYS-GDLPDMGYILDNSVQMWFDEVHNSNAGIIAGGYPSGYNGPAIGHFTVMMSERNTRLGC 191
            ....:| |...|: .:|.:.:..||.:...::..:.|....|.     |..|..::.|.:|.:||
  Fly   134 GHVIFSAGKHSDL-ELLRHKISNWFGQYMRASKDLQAADPSSN-----ISSFRQLIQESSTHMGC 192

  Fly   192 AAARYNRDG-WNQVLVACNYATTNMIGRQIYSSCDWGAQGCGSGTNGEFGNLCSTSEWYDVNS 253
            ...|..... |:|..:.||:|..||...|:| .....|.||.||.|..:.|||:..|.||||:
  Fly   193 GVLRQRSHMLWHQQFIVCNFARRNMPREQVY-QVGVAATGCRSGRNPRYPNLCALQEEYDVNA 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ag5r2NP_524689.2 SCP_euk 62..211 CDD:240180 48/150 (32%)
CG3640NP_611950.1 SCP_euk 65..213 CDD:240180 48/153 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440590
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Homologene 1 1.000 - - H77274
Inparanoid 1 1.050 76 1.000 Inparanoid score I5251
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26030
OrthoDB 1 1.010 - - D109749at50557
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
109.910

Return to query results.
Submit another query.