DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ag5r2 and CG9822

DIOPT Version :9

Sequence 1:NP_524689.2 Gene:Ag5r2 / 44079 FlyBaseID:FBgn0020508 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_611581.1 Gene:CG9822 / 37440 FlyBaseID:FBgn0034623 Length:263 Species:Drosophila melanogaster


Alignment Length:262 Identity:91/262 - (34%)
Similarity:142/262 - (54%) Gaps:32/262 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ILIVSLALAQATDYCSSDICNGGS-HIACGHSNWWDSSCPGDAELIDINDDYKWVFVHSHNDKRN 71
            ::|:.:|.:|...:|..|:|...: ||||.:...:..||..||.::|:. .|:.:.|:.||.:||
  Fly    13 LIILGMASSQPLSWCDPDLCPDNTVHIACNNDGKFHESCSPDATMVDLK-PYRKLIVNEHNKRRN 76

  Fly    72 YIAGGYDSNHNAACRMATMEWDDELAYLASLNVRQCNMVHDSCHNTDAFKYSGQNLA-------W 129
            |||.|....:..|.|||||.||:||.|||:||::.|.:.||.|||:..|:..||||.       |
  Fly    77 YIASGSLPGYYPATRMATMVWDEELEYLATLNLKTCYLEHDDCHNSYRFRNLGQNLCGVDRRRNW 141

  Fly   130 QAYSGDLPDMGYILDNSVQMWFDEVHNSNAGIIAGGYPSGY----NGPAIGHFTVMMSERNTRLG 190
                 || ::..:::.|:.:||.| |.    :|...|.:.:    :....|||...:.:|||.:|
  Fly   142 -----DL-NVTNLVEQSMGLWFGE-HK----LIDSSYITDFKLTKDLEKYGHFVETVLDRNTHVG 195

  Fly   191 CAAARYNRDGWNQVLV---ACNYATTNMIGRQIYSSCDWG--AQGCGSGTNGEFGNLCSTSEWYD 250
            ||..|:....:..:.:   |||||:...||..:|::   |  |..|.:|:|.|:..|||..|.|:
  Fly   196 CAMMRFTNPQYPFLYIYNTACNYASVYAIGVPVYNA---GKPASECRTGSNPEYPALCSIKEQYN 257

  Fly   251 VN 252
            .|
  Fly   258 PN 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ag5r2NP_524689.2 SCP_euk 62..211 CDD:240180 58/162 (36%)
CG9822NP_611581.1 SCP_euk 64..219 CDD:240180 58/165 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440523
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Homologene 1 1.000 - - H77274
Inparanoid 1 1.050 76 1.000 Inparanoid score I5251
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26030
OrthoDB 1 1.010 - - D109749at50557
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
109.910

Return to query results.
Submit another query.